Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5FS89

Protein Details
Accession M5FS89    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
65-89TVRGARRAKVGPRRKRVRARGQREVBasic
NLS Segment(s)
PositionSequence
58-87REWVRSSTVRGARRAKVGPRRKRVRARGQR
Subcellular Location(s) mito 11, cyto_nucl 8, nucl 7, cyto 7
Family & Domain DBs
Amino Acid Sequences PSGSNLPASSSSLSHPLPTLPTSPLSLSRLTSTHHLTLSSLIRAKDSLTRVRAGSARREWVRSSTVRGARRAKVGPRRKRVRARGQREV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.17
4 0.18
5 0.19
6 0.19
7 0.16
8 0.17
9 0.18
10 0.18
11 0.21
12 0.2
13 0.2
14 0.19
15 0.18
16 0.18
17 0.18
18 0.2
19 0.2
20 0.2
21 0.19
22 0.18
23 0.17
24 0.19
25 0.19
26 0.18
27 0.17
28 0.15
29 0.15
30 0.15
31 0.15
32 0.16
33 0.18
34 0.2
35 0.2
36 0.22
37 0.21
38 0.23
39 0.26
40 0.24
41 0.28
42 0.27
43 0.32
44 0.33
45 0.35
46 0.34
47 0.34
48 0.37
49 0.32
50 0.35
51 0.36
52 0.41
53 0.43
54 0.49
55 0.52
56 0.5
57 0.55
58 0.54
59 0.55
60 0.59
61 0.65
62 0.68
63 0.73
64 0.79
65 0.83
66 0.88
67 0.9
68 0.9
69 0.91