Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5GBR0

Protein Details
Accession M5GBR0    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-34LYSKGRVLGHKRAKRNSRPNTSLLHydrophilic
NLS Segment(s)
PositionSequence
19-25GHKRAKR
Subcellular Location(s) mito 16.5, mito_nucl 13, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MNIRLIHLRRLYSKGRVLGHKRAKRNSRPNTSLLQIEGVTNKEDAQFYLGKRVAYVYKAQKEVRGSKIRIIWGRVTRPHGNSGVVKGKFRSNLPPKAFGASVRIMLYPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.5
3 0.56
4 0.58
5 0.63
6 0.68
7 0.69
8 0.72
9 0.75
10 0.8
11 0.81
12 0.85
13 0.85
14 0.84
15 0.8
16 0.75
17 0.7
18 0.62
19 0.53
20 0.42
21 0.34
22 0.24
23 0.2
24 0.18
25 0.14
26 0.13
27 0.11
28 0.11
29 0.1
30 0.1
31 0.09
32 0.11
33 0.12
34 0.12
35 0.18
36 0.2
37 0.18
38 0.18
39 0.19
40 0.18
41 0.17
42 0.22
43 0.22
44 0.24
45 0.28
46 0.29
47 0.31
48 0.34
49 0.38
50 0.41
51 0.42
52 0.39
53 0.39
54 0.42
55 0.44
56 0.43
57 0.4
58 0.39
59 0.37
60 0.41
61 0.41
62 0.44
63 0.44
64 0.44
65 0.45
66 0.4
67 0.38
68 0.34
69 0.35
70 0.37
71 0.34
72 0.33
73 0.31
74 0.34
75 0.34
76 0.35
77 0.4
78 0.4
79 0.48
80 0.51
81 0.55
82 0.52
83 0.53
84 0.51
85 0.41
86 0.38
87 0.3
88 0.29
89 0.24
90 0.23
91 0.2