Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5FT71

Protein Details
Accession M5FT71   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
121-147EELTAQRKKMRKESRERIRQQNFMKTTHydrophilic
NLS Segment(s)
PositionSequence
83-97KAGAKGKGKGRVAPH
112-115ERRR
126-136QRKKMRKESRE
Subcellular Location(s) mito 22.5, cyto_mito 12.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MTSLWIGTSRSALFLRNGSLVCTRHARRGMAVKVPSKPPPTSSCPPGTVLTGIQYLKDAPPVIAMPDTDYPAWLWTLLDEPAKAGAKGKGKGRVAPHKTEDGAEELDEKERERRRILKDEEELTAQRKKMRKESRERIRQQNFMKTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.21
4 0.21
5 0.2
6 0.25
7 0.24
8 0.25
9 0.31
10 0.31
11 0.36
12 0.4
13 0.38
14 0.38
15 0.46
16 0.47
17 0.46
18 0.5
19 0.47
20 0.48
21 0.51
22 0.52
23 0.48
24 0.45
25 0.42
26 0.42
27 0.45
28 0.46
29 0.47
30 0.44
31 0.41
32 0.43
33 0.39
34 0.34
35 0.27
36 0.22
37 0.18
38 0.17
39 0.15
40 0.12
41 0.12
42 0.11
43 0.1
44 0.12
45 0.1
46 0.07
47 0.08
48 0.09
49 0.09
50 0.09
51 0.08
52 0.09
53 0.1
54 0.11
55 0.1
56 0.1
57 0.09
58 0.09
59 0.09
60 0.07
61 0.05
62 0.04
63 0.06
64 0.07
65 0.07
66 0.06
67 0.06
68 0.09
69 0.1
70 0.1
71 0.1
72 0.13
73 0.18
74 0.22
75 0.26
76 0.31
77 0.32
78 0.36
79 0.42
80 0.48
81 0.48
82 0.5
83 0.49
84 0.45
85 0.45
86 0.41
87 0.35
88 0.27
89 0.23
90 0.17
91 0.15
92 0.13
93 0.15
94 0.15
95 0.14
96 0.19
97 0.25
98 0.29
99 0.33
100 0.41
101 0.45
102 0.55
103 0.6
104 0.61
105 0.61
106 0.6
107 0.56
108 0.52
109 0.47
110 0.41
111 0.4
112 0.33
113 0.34
114 0.37
115 0.41
116 0.48
117 0.57
118 0.63
119 0.69
120 0.78
121 0.83
122 0.88
123 0.9
124 0.9
125 0.88
126 0.87
127 0.83