Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5FN94

Protein Details
Accession M5FN94    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
18-46SQFHPRRPRAPTHQERRARSPNRWKRRGABasic
100-122TPSHTHKQTEHKHQPHHHSHPESBasic
NLS Segment(s)
PositionSequence
23-47RRPRAPTHQERRARSPNRWKRRGAA
Subcellular Location(s) mito 17, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MSPGRRRGGMASLVMGTSQFHPRRPRAPTHQERRARSPNRWKRRGAAASRAPLDAVVPSSSSAAAQGEATPEAKPREEACGGQPCQGDAAVHPEVSPHATPSHTHKQTEHKHQPHHHSHPESHKSKPPSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.14
4 0.12
5 0.2
6 0.21
7 0.26
8 0.34
9 0.4
10 0.47
11 0.51
12 0.58
13 0.59
14 0.68
15 0.73
16 0.75
17 0.8
18 0.8
19 0.8
20 0.8
21 0.81
22 0.75
23 0.74
24 0.75
25 0.76
26 0.79
27 0.8
28 0.74
29 0.69
30 0.73
31 0.72
32 0.66
33 0.65
34 0.6
35 0.59
36 0.57
37 0.52
38 0.41
39 0.32
40 0.27
41 0.18
42 0.12
43 0.07
44 0.06
45 0.06
46 0.06
47 0.07
48 0.06
49 0.06
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.06
56 0.06
57 0.06
58 0.08
59 0.09
60 0.1
61 0.11
62 0.11
63 0.16
64 0.16
65 0.17
66 0.19
67 0.27
68 0.27
69 0.3
70 0.29
71 0.24
72 0.24
73 0.23
74 0.19
75 0.1
76 0.15
77 0.12
78 0.12
79 0.12
80 0.12
81 0.12
82 0.15
83 0.15
84 0.1
85 0.11
86 0.12
87 0.14
88 0.22
89 0.32
90 0.33
91 0.35
92 0.38
93 0.47
94 0.55
95 0.65
96 0.68
97 0.65
98 0.71
99 0.77
100 0.83
101 0.83
102 0.83
103 0.82
104 0.77
105 0.77
106 0.78
107 0.8
108 0.73
109 0.7
110 0.69