Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5G4G6

Protein Details
Accession M5G4G6    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
419-444TPLSTGPTKSPRRKGSLRRRMRYSQIHydrophilic
NLS Segment(s)
PositionSequence
428-438SPRRKGSLRRR
Subcellular Location(s) plas 8, nucl 6.5, cyto_nucl 6, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036028  SH3-like_dom_sf  
IPR001452  SH3_domain  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF14604  SH3_9  
PROSITE View protein in PROSITE  
PS50002  SH3  
Amino Acid Sequences MAVIHDLHANLKRKPSELALERRAIPRATAFATPDGAQVLEVRAGPSTSSSHHLAITPGASPASPAPTPNASSGTGSSSRGTPVFVPVLATVFSVLGVLLFGFLLFLLCRRRKKTTSATKVEAQKREKWGARWRQRGQDSSDAGSPPFMGYMGPASSDRTSSPSFLSPNTGAQLVNAPTSPSGWGPFHITPYRISFAVRMPLKSQPSKQKQAAIVGPKDLVLPSKPSRFYDRRSPPGGSQVSIFTRPSYRSRRTEGTPPPSYNSRGTSGRTLATLATNGSRSTSGRTPPSLPPVVTGPALNLIPPAPQSGEELSPYQPIPSAVLTPFDQVVIFPTTNLPLPRKMVVVSTFTPALSDEMSIQVGQILKLVEEYDDGWCLVERKAVNGQKAEQGAVPRFCLDEIHPDEPGTGSFSVRSMATPLSTGPTKSPRRKGSLRRRMRYSQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.44
3 0.47
4 0.5
5 0.57
6 0.55
7 0.57
8 0.59
9 0.59
10 0.58
11 0.49
12 0.41
13 0.35
14 0.32
15 0.3
16 0.29
17 0.28
18 0.26
19 0.28
20 0.26
21 0.24
22 0.2
23 0.17
24 0.14
25 0.13
26 0.12
27 0.12
28 0.12
29 0.11
30 0.11
31 0.11
32 0.11
33 0.12
34 0.13
35 0.13
36 0.17
37 0.2
38 0.2
39 0.21
40 0.22
41 0.21
42 0.21
43 0.19
44 0.16
45 0.13
46 0.12
47 0.11
48 0.11
49 0.12
50 0.15
51 0.14
52 0.14
53 0.18
54 0.21
55 0.23
56 0.24
57 0.25
58 0.21
59 0.22
60 0.23
61 0.24
62 0.22
63 0.22
64 0.21
65 0.19
66 0.2
67 0.19
68 0.19
69 0.15
70 0.17
71 0.17
72 0.16
73 0.16
74 0.14
75 0.15
76 0.14
77 0.13
78 0.1
79 0.08
80 0.08
81 0.06
82 0.05
83 0.04
84 0.04
85 0.04
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.06
94 0.15
95 0.21
96 0.28
97 0.34
98 0.42
99 0.45
100 0.54
101 0.62
102 0.65
103 0.7
104 0.71
105 0.7
106 0.69
107 0.75
108 0.75
109 0.72
110 0.66
111 0.62
112 0.61
113 0.64
114 0.61
115 0.59
116 0.61
117 0.64
118 0.69
119 0.73
120 0.72
121 0.73
122 0.74
123 0.72
124 0.68
125 0.65
126 0.57
127 0.49
128 0.46
129 0.38
130 0.32
131 0.27
132 0.22
133 0.13
134 0.11
135 0.08
136 0.05
137 0.05
138 0.06
139 0.06
140 0.07
141 0.07
142 0.1
143 0.1
144 0.11
145 0.12
146 0.14
147 0.15
148 0.15
149 0.17
150 0.17
151 0.18
152 0.18
153 0.21
154 0.18
155 0.18
156 0.18
157 0.17
158 0.14
159 0.13
160 0.16
161 0.13
162 0.12
163 0.11
164 0.1
165 0.09
166 0.1
167 0.11
168 0.07
169 0.09
170 0.09
171 0.1
172 0.15
173 0.15
174 0.19
175 0.2
176 0.21
177 0.2
178 0.23
179 0.24
180 0.19
181 0.19
182 0.16
183 0.15
184 0.22
185 0.22
186 0.19
187 0.2
188 0.25
189 0.29
190 0.31
191 0.36
192 0.39
193 0.45
194 0.52
195 0.52
196 0.52
197 0.49
198 0.5
199 0.49
200 0.44
201 0.37
202 0.31
203 0.28
204 0.23
205 0.21
206 0.17
207 0.13
208 0.08
209 0.12
210 0.14
211 0.19
212 0.2
213 0.22
214 0.3
215 0.33
216 0.37
217 0.42
218 0.48
219 0.49
220 0.52
221 0.52
222 0.45
223 0.5
224 0.46
225 0.36
226 0.29
227 0.25
228 0.23
229 0.23
230 0.22
231 0.14
232 0.15
233 0.18
234 0.24
235 0.3
236 0.35
237 0.38
238 0.43
239 0.47
240 0.48
241 0.55
242 0.56
243 0.56
244 0.55
245 0.52
246 0.49
247 0.48
248 0.48
249 0.41
250 0.35
251 0.31
252 0.27
253 0.28
254 0.28
255 0.27
256 0.24
257 0.22
258 0.2
259 0.16
260 0.14
261 0.13
262 0.1
263 0.09
264 0.1
265 0.09
266 0.1
267 0.1
268 0.1
269 0.14
270 0.17
271 0.2
272 0.23
273 0.25
274 0.28
275 0.31
276 0.37
277 0.35
278 0.31
279 0.28
280 0.27
281 0.26
282 0.23
283 0.2
284 0.13
285 0.13
286 0.13
287 0.11
288 0.09
289 0.08
290 0.08
291 0.08
292 0.09
293 0.07
294 0.08
295 0.1
296 0.12
297 0.13
298 0.14
299 0.15
300 0.15
301 0.16
302 0.16
303 0.14
304 0.13
305 0.12
306 0.12
307 0.11
308 0.13
309 0.11
310 0.14
311 0.14
312 0.14
313 0.14
314 0.13
315 0.12
316 0.09
317 0.12
318 0.13
319 0.12
320 0.11
321 0.12
322 0.13
323 0.16
324 0.2
325 0.19
326 0.19
327 0.22
328 0.23
329 0.24
330 0.23
331 0.24
332 0.23
333 0.26
334 0.24
335 0.24
336 0.23
337 0.22
338 0.21
339 0.18
340 0.17
341 0.12
342 0.11
343 0.09
344 0.09
345 0.1
346 0.1
347 0.09
348 0.1
349 0.1
350 0.09
351 0.11
352 0.09
353 0.09
354 0.09
355 0.1
356 0.08
357 0.08
358 0.09
359 0.09
360 0.1
361 0.1
362 0.1
363 0.1
364 0.12
365 0.11
366 0.15
367 0.14
368 0.17
369 0.27
370 0.31
371 0.35
372 0.37
373 0.39
374 0.4
375 0.41
376 0.38
377 0.31
378 0.32
379 0.34
380 0.32
381 0.31
382 0.26
383 0.26
384 0.24
385 0.24
386 0.2
387 0.24
388 0.29
389 0.3
390 0.3
391 0.29
392 0.3
393 0.28
394 0.27
395 0.2
396 0.14
397 0.12
398 0.12
399 0.13
400 0.14
401 0.13
402 0.13
403 0.12
404 0.13
405 0.13
406 0.13
407 0.14
408 0.18
409 0.2
410 0.2
411 0.24
412 0.33
413 0.42
414 0.51
415 0.61
416 0.64
417 0.71
418 0.8
419 0.85
420 0.87
421 0.87
422 0.89
423 0.88
424 0.88