Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5FR93

Protein Details
Accession M5FR93   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
62-81ISRGIRSYRESKRRRRLIIQHydrophilic
NLS Segment(s)
PositionSequence
69-88YRESKRRRRLIIQAGPGRKG
Subcellular Location(s) plas 9, extr 6, cyto 4, mito 3, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSEASSTLLSSASSSSTSAAASPSASTYNSLLQSFKSKVVLTATIGGVLVLAVTIFLAVFKISRGIRSYRESKRRRRLIIQAGPGRKGRNAYEIFEWEGVPTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.1
5 0.09
6 0.09
7 0.09
8 0.08
9 0.08
10 0.09
11 0.09
12 0.1
13 0.11
14 0.11
15 0.14
16 0.16
17 0.16
18 0.15
19 0.15
20 0.2
21 0.2
22 0.2
23 0.19
24 0.17
25 0.17
26 0.19
27 0.19
28 0.15
29 0.16
30 0.14
31 0.12
32 0.12
33 0.1
34 0.08
35 0.06
36 0.05
37 0.02
38 0.02
39 0.01
40 0.01
41 0.02
42 0.01
43 0.02
44 0.02
45 0.02
46 0.02
47 0.03
48 0.07
49 0.07
50 0.1
51 0.13
52 0.15
53 0.2
54 0.26
55 0.34
56 0.4
57 0.51
58 0.58
59 0.66
60 0.74
61 0.79
62 0.8
63 0.79
64 0.79
65 0.79
66 0.79
67 0.78
68 0.76
69 0.71
70 0.68
71 0.64
72 0.56
73 0.48
74 0.43
75 0.36
76 0.36
77 0.36
78 0.35
79 0.37
80 0.38
81 0.39
82 0.36
83 0.33