Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7F8X4

Protein Details
Accession A7F8X4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPAENTKKKFKKQKILKTRELAPPHydrophilic
NLS Segment(s)
PositionSequence
8-14KKFKKQK
Subcellular Location(s) mito 20, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
KEGG ssl:SS1G_14055  -  
Amino Acid Sequences MPAENTKKKFKKQKILKTRELAPPQFSLIFGRIDRATQHVFKNGMKYVPLYLSIVPHMSRSRFLSLSTDVATASVGAGQGSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.91
3 0.9
4 0.85
5 0.82
6 0.8
7 0.77
8 0.69
9 0.61
10 0.53
11 0.45
12 0.4
13 0.33
14 0.25
15 0.19
16 0.18
17 0.14
18 0.16
19 0.13
20 0.14
21 0.14
22 0.16
23 0.17
24 0.18
25 0.19
26 0.2
27 0.22
28 0.22
29 0.25
30 0.23
31 0.2
32 0.18
33 0.17
34 0.15
35 0.14
36 0.14
37 0.12
38 0.11
39 0.11
40 0.11
41 0.12
42 0.11
43 0.14
44 0.15
45 0.15
46 0.18
47 0.2
48 0.24
49 0.23
50 0.24
51 0.25
52 0.25
53 0.26
54 0.25
55 0.22
56 0.17
57 0.17
58 0.16
59 0.11
60 0.09
61 0.07
62 0.05
63 0.05