Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5GAL6

Protein Details
Accession M5GAL6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
30-59TPPGRPTRGSQRRQRSRPTRKGRHLSRAIQHydrophilic
NLS Segment(s)
PositionSequence
29-73RTPPGRPTRGSQRRQRSRPTRKGRHLSRAIQTLRIPRGLERRGRR
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
Amino Acid Sequences MSSLTVELAPLPLWGHALSRHMFRAPALRTPPGRPTRGSQRRQRSRPTRKGRHLSRAIQTLRIPRGLERRGRRLLALSSGPGFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.1
4 0.14
5 0.15
6 0.17
7 0.19
8 0.18
9 0.19
10 0.18
11 0.24
12 0.23
13 0.28
14 0.29
15 0.32
16 0.33
17 0.36
18 0.44
19 0.42
20 0.43
21 0.38
22 0.4
23 0.46
24 0.54
25 0.58
26 0.58
27 0.64
28 0.71
29 0.75
30 0.8
31 0.8
32 0.81
33 0.84
34 0.86
35 0.85
36 0.85
37 0.9
38 0.87
39 0.86
40 0.83
41 0.78
42 0.73
43 0.71
44 0.62
45 0.57
46 0.53
47 0.49
48 0.44
49 0.41
50 0.36
51 0.32
52 0.4
53 0.42
54 0.48
55 0.49
56 0.55
57 0.59
58 0.59
59 0.56
60 0.52
61 0.49
62 0.46
63 0.4
64 0.35