Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EJL3

Protein Details
Accession A7EJL3    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
270-292GGYLNIPKTRNRKPRQSNEEFIIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 4, cyto 2.5
Family & Domain DBs
KEGG ssl:SS1G_05507  -  
Amino Acid Sequences MSWITKNWIARYLKPGHKFKIGNNIWELSGNPINEAEYEDFSRAVYECKLVDERGGEEIKSPAVVKIWMQTPEINTYEDWFYASELYDLYLAENLDTAGDPDIDIASHMGSPEQFVSAGNSDIASDSNFAGHSNPADKSDSDGHSDITNHPNSNTHSNSTYNSDINSATHPIPALNSQSPSNSNSNSNPNPNTTNLINPPNYPEPWDSELTCLNLLNKSYTTLHHTPNIPNTTNTSAQEKSKIPSDTYKPFPYAIGLAKYKQRRNFPLEGGYLNIPKTRNRKPRQSNEEFIIGKHGDIVMKKHGPLFRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.67
3 0.64
4 0.69
5 0.67
6 0.63
7 0.65
8 0.6
9 0.57
10 0.53
11 0.49
12 0.41
13 0.38
14 0.34
15 0.29
16 0.3
17 0.23
18 0.2
19 0.19
20 0.19
21 0.18
22 0.21
23 0.17
24 0.15
25 0.17
26 0.17
27 0.17
28 0.16
29 0.17
30 0.14
31 0.14
32 0.12
33 0.13
34 0.12
35 0.16
36 0.18
37 0.18
38 0.19
39 0.19
40 0.19
41 0.22
42 0.22
43 0.18
44 0.17
45 0.18
46 0.16
47 0.16
48 0.15
49 0.11
50 0.11
51 0.12
52 0.11
53 0.14
54 0.18
55 0.19
56 0.2
57 0.22
58 0.23
59 0.27
60 0.27
61 0.24
62 0.2
63 0.2
64 0.2
65 0.18
66 0.16
67 0.11
68 0.11
69 0.1
70 0.1
71 0.08
72 0.07
73 0.07
74 0.07
75 0.07
76 0.06
77 0.07
78 0.07
79 0.06
80 0.06
81 0.06
82 0.06
83 0.06
84 0.06
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05
92 0.05
93 0.04
94 0.04
95 0.05
96 0.05
97 0.05
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.08
104 0.08
105 0.09
106 0.08
107 0.07
108 0.07
109 0.07
110 0.08
111 0.06
112 0.06
113 0.05
114 0.06
115 0.06
116 0.06
117 0.07
118 0.07
119 0.07
120 0.09
121 0.09
122 0.11
123 0.12
124 0.12
125 0.14
126 0.18
127 0.18
128 0.2
129 0.2
130 0.18
131 0.18
132 0.19
133 0.18
134 0.19
135 0.19
136 0.16
137 0.16
138 0.18
139 0.2
140 0.24
141 0.23
142 0.2
143 0.2
144 0.21
145 0.22
146 0.24
147 0.23
148 0.18
149 0.17
150 0.16
151 0.14
152 0.14
153 0.14
154 0.12
155 0.11
156 0.11
157 0.1
158 0.09
159 0.1
160 0.1
161 0.13
162 0.12
163 0.13
164 0.13
165 0.15
166 0.16
167 0.19
168 0.2
169 0.18
170 0.2
171 0.21
172 0.28
173 0.3
174 0.34
175 0.32
176 0.32
177 0.33
178 0.31
179 0.32
180 0.25
181 0.26
182 0.25
183 0.28
184 0.26
185 0.25
186 0.29
187 0.29
188 0.28
189 0.27
190 0.24
191 0.24
192 0.27
193 0.29
194 0.24
195 0.22
196 0.24
197 0.22
198 0.21
199 0.17
200 0.14
201 0.14
202 0.14
203 0.14
204 0.13
205 0.14
206 0.15
207 0.16
208 0.23
209 0.25
210 0.27
211 0.31
212 0.34
213 0.34
214 0.41
215 0.45
216 0.39
217 0.35
218 0.37
219 0.37
220 0.37
221 0.35
222 0.32
223 0.29
224 0.29
225 0.34
226 0.31
227 0.29
228 0.32
229 0.33
230 0.3
231 0.36
232 0.41
233 0.43
234 0.47
235 0.49
236 0.44
237 0.43
238 0.4
239 0.34
240 0.31
241 0.28
242 0.27
243 0.26
244 0.27
245 0.35
246 0.43
247 0.48
248 0.52
249 0.57
250 0.59
251 0.64
252 0.68
253 0.65
254 0.63
255 0.59
256 0.52
257 0.46
258 0.42
259 0.36
260 0.31
261 0.3
262 0.24
263 0.29
264 0.36
265 0.44
266 0.51
267 0.58
268 0.68
269 0.76
270 0.85
271 0.89
272 0.89
273 0.85
274 0.79
275 0.79
276 0.68
277 0.58
278 0.53
279 0.43
280 0.34
281 0.28
282 0.25
283 0.19
284 0.21
285 0.24
286 0.26
287 0.3
288 0.31
289 0.36