Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5G9Z6

Protein Details
Accession M5G9Z6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
88-111VHKNCAHLTHRKKRMYKHSYQSLEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 15, mito 7, plas 4, mito_nucl 4
Family & Domain DBs
Amino Acid Sequences MPSTKQLLFLAIAASTVLAAPMQMKKTEATINTDLTMTEAPSAASAPISGDGVVPPSPAKVVPPSAPTFSQRRKHDGAYRRQGRRGCVHKNCAHLTHRKKRMYKHSYQSLENGPASPTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.06
3 0.05
4 0.05
5 0.03
6 0.04
7 0.06
8 0.1
9 0.12
10 0.12
11 0.14
12 0.14
13 0.17
14 0.21
15 0.21
16 0.24
17 0.25
18 0.26
19 0.25
20 0.25
21 0.22
22 0.19
23 0.18
24 0.11
25 0.08
26 0.07
27 0.06
28 0.06
29 0.07
30 0.05
31 0.05
32 0.04
33 0.04
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.07
47 0.07
48 0.09
49 0.1
50 0.14
51 0.16
52 0.17
53 0.19
54 0.21
55 0.27
56 0.33
57 0.4
58 0.4
59 0.44
60 0.46
61 0.5
62 0.55
63 0.57
64 0.59
65 0.62
66 0.68
67 0.66
68 0.69
69 0.67
70 0.64
71 0.64
72 0.62
73 0.62
74 0.61
75 0.65
76 0.64
77 0.68
78 0.66
79 0.63
80 0.6
81 0.6
82 0.62
83 0.63
84 0.69
85 0.7
86 0.73
87 0.77
88 0.82
89 0.81
90 0.81
91 0.8
92 0.81
93 0.78
94 0.74
95 0.7
96 0.65
97 0.62
98 0.53
99 0.43