Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5FRQ7

Protein Details
Accession M5FRQ7    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
48-76QNQQQNQQKQKQEKQTQKEKDKEKEKEQAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
Amino Acid Sequences MLLLPCLWREKSLGVRMQLRELRTLGSYPQKHQHQQQQQNQQTQTQTQNQQQNQQKQKQEKQTQKEKDKEKEKEQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.45
3 0.45
4 0.51
5 0.5
6 0.43
7 0.39
8 0.34
9 0.3
10 0.25
11 0.24
12 0.2
13 0.25
14 0.26
15 0.27
16 0.35
17 0.38
18 0.41
19 0.46
20 0.52
21 0.53
22 0.61
23 0.66
24 0.68
25 0.69
26 0.71
27 0.66
28 0.59
29 0.5
30 0.44
31 0.41
32 0.36
33 0.36
34 0.36
35 0.44
36 0.43
37 0.5
38 0.55
39 0.6
40 0.63
41 0.66
42 0.67
43 0.69
44 0.76
45 0.78
46 0.8
47 0.8
48 0.8
49 0.83
50 0.86
51 0.86
52 0.86
53 0.85
54 0.85
55 0.86
56 0.85