Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5G849

Protein Details
Accession M5G849    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
157-184VFATHVVTQRKKKLWRRKGDKLEYPYKEHydrophilic
NLS Segment(s)
PositionSequence
166-175RKKKLWRRKG
Subcellular Location(s) cyto 11, nucl 10, pero 5, mito_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009446  Mgm101  
Gene Ontology GO:0000262  C:mitochondrial chromosome  
GO:0003697  F:single-stranded DNA binding  
GO:0006281  P:DNA repair  
GO:0000002  P:mitochondrial genome maintenance  
Pfam View protein in Pfam  
PF06420  Mgm101p  
Amino Acid Sequences MGPLPEPGDGRPTDWSRSYHGLSSQPFPKDIAEILMAPLDPEDVEIKPDGLIYLPEIKYRRILNKAFGPGGWGLAPRGETNVSPKVVSREYALVCLGRLVGIARGEQEYFDPSGIATATEACKSNALMRCCKDLGIASELWDPRFIREFKAKHCSEVFATHVVTQRKKKLWRRKGDKLEYPYKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.35
4 0.41
5 0.41
6 0.37
7 0.37
8 0.39
9 0.38
10 0.42
11 0.42
12 0.38
13 0.36
14 0.34
15 0.31
16 0.26
17 0.24
18 0.2
19 0.15
20 0.14
21 0.13
22 0.13
23 0.12
24 0.1
25 0.09
26 0.07
27 0.05
28 0.06
29 0.08
30 0.07
31 0.09
32 0.09
33 0.09
34 0.09
35 0.09
36 0.08
37 0.07
38 0.07
39 0.07
40 0.14
41 0.14
42 0.18
43 0.2
44 0.2
45 0.24
46 0.28
47 0.32
48 0.32
49 0.34
50 0.35
51 0.4
52 0.43
53 0.4
54 0.35
55 0.32
56 0.24
57 0.23
58 0.18
59 0.12
60 0.08
61 0.08
62 0.09
63 0.07
64 0.08
65 0.08
66 0.08
67 0.12
68 0.16
69 0.16
70 0.15
71 0.16
72 0.18
73 0.18
74 0.18
75 0.15
76 0.15
77 0.15
78 0.15
79 0.15
80 0.12
81 0.11
82 0.1
83 0.09
84 0.05
85 0.05
86 0.04
87 0.05
88 0.06
89 0.06
90 0.07
91 0.07
92 0.08
93 0.08
94 0.08
95 0.08
96 0.08
97 0.08
98 0.07
99 0.06
100 0.07
101 0.07
102 0.06
103 0.04
104 0.05
105 0.06
106 0.08
107 0.09
108 0.09
109 0.1
110 0.1
111 0.16
112 0.21
113 0.24
114 0.29
115 0.3
116 0.34
117 0.34
118 0.33
119 0.28
120 0.24
121 0.24
122 0.21
123 0.19
124 0.17
125 0.21
126 0.22
127 0.21
128 0.23
129 0.2
130 0.19
131 0.26
132 0.24
133 0.25
134 0.33
135 0.36
136 0.4
137 0.5
138 0.48
139 0.47
140 0.48
141 0.46
142 0.4
143 0.4
144 0.35
145 0.28
146 0.29
147 0.27
148 0.32
149 0.35
150 0.39
151 0.43
152 0.49
153 0.55
154 0.64
155 0.71
156 0.76
157 0.81
158 0.85
159 0.87
160 0.89
161 0.92
162 0.92
163 0.91
164 0.89