Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5G8Z6

Protein Details
Accession M5G8Z6    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-36LDARLGRHPRRSPPRQYTRRLRFENQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 3.5, cyto_nucl 3.5, nucl 2.5
Family & Domain DBs
Amino Acid Sequences MVCTGGVGHALDARLGRHPRRSPPRQYTRRLRFENQALRLRICILSWQLPGIASVSRQLSIKDFRDPVLDRNEFMQVDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.23
3 0.27
4 0.34
5 0.39
6 0.49
7 0.59
8 0.66
9 0.69
10 0.74
11 0.81
12 0.81
13 0.85
14 0.86
15 0.85
16 0.86
17 0.82
18 0.75
19 0.7
20 0.71
21 0.69
22 0.65
23 0.62
24 0.53
25 0.48
26 0.44
27 0.39
28 0.3
29 0.22
30 0.17
31 0.12
32 0.13
33 0.13
34 0.13
35 0.12
36 0.12
37 0.12
38 0.11
39 0.09
40 0.06
41 0.09
42 0.1
43 0.11
44 0.11
45 0.12
46 0.15
47 0.21
48 0.23
49 0.27
50 0.27
51 0.27
52 0.34
53 0.35
54 0.36
55 0.39
56 0.38
57 0.33
58 0.34
59 0.38