Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5FNM2

Protein Details
Accession M5FNM2    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAKGLRSKVKRSFRRAKREDSVYHydrophilic
58-89EKISTHGKRDNRKEQWKKAKGFDKASKSRRKMBasic
NLS Segment(s)
PositionSequence
6-18RSKVKRSFRRAKR
64-101GKRDNRKEQWKKAKGFDKASKSRRKMFGGVGGKGKARR
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKGLRSKVKRSFRRAKREDSVYAATHAARVERLHRKLADKIQTDVEGEDGDEPEEEEKISTHGKRDNRKEQWKKAKGFDKASKSRRKMFGGVGGKGKARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.84
4 0.82
5 0.79
6 0.72
7 0.68
8 0.62
9 0.52
10 0.47
11 0.39
12 0.3
13 0.25
14 0.21
15 0.16
16 0.12
17 0.12
18 0.18
19 0.26
20 0.29
21 0.32
22 0.35
23 0.38
24 0.42
25 0.48
26 0.49
27 0.42
28 0.41
29 0.38
30 0.36
31 0.33
32 0.27
33 0.2
34 0.12
35 0.1
36 0.08
37 0.06
38 0.05
39 0.05
40 0.05
41 0.04
42 0.05
43 0.04
44 0.04
45 0.04
46 0.06
47 0.1
48 0.11
49 0.14
50 0.2
51 0.27
52 0.36
53 0.45
54 0.54
55 0.6
56 0.71
57 0.77
58 0.82
59 0.87
60 0.87
61 0.83
62 0.82
63 0.8
64 0.77
65 0.77
66 0.75
67 0.74
68 0.75
69 0.79
70 0.8
71 0.78
72 0.79
73 0.77
74 0.74
75 0.68
76 0.63
77 0.64
78 0.61
79 0.59
80 0.56
81 0.51