Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5G6Q7

Protein Details
Accession M5G6Q7    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MPYPTIPKRKRAKHTRRRGPPKDPTGPCYBasic
NLS Segment(s)
PositionSequence
7-22PKRKRAKHTRRRGPPK
Subcellular Location(s) mito 17, nucl 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
IPR001810  F-box_dom  
Pfam View protein in Pfam  
PF12937  F-box-like  
Amino Acid Sequences MPYPTIPKRKRAKHTRRRGPPKDPTGPCYIERLPLELLSEIFTLCERDERRLGGSEIPVDESCAVRFSLVNRFWRRAALCTPALWTTVCISTNHHMHRAVRWMERSKRRNLTVTMFATHPVTVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.93
3 0.94
4 0.95
5 0.94
6 0.93
7 0.92
8 0.9
9 0.89
10 0.82
11 0.75
12 0.71
13 0.65
14 0.56
15 0.52
16 0.43
17 0.38
18 0.34
19 0.32
20 0.26
21 0.23
22 0.23
23 0.17
24 0.17
25 0.12
26 0.12
27 0.09
28 0.08
29 0.08
30 0.08
31 0.07
32 0.13
33 0.12
34 0.16
35 0.17
36 0.18
37 0.2
38 0.21
39 0.22
40 0.18
41 0.18
42 0.16
43 0.15
44 0.16
45 0.13
46 0.12
47 0.11
48 0.09
49 0.08
50 0.08
51 0.08
52 0.06
53 0.07
54 0.08
55 0.16
56 0.19
57 0.27
58 0.29
59 0.32
60 0.32
61 0.36
62 0.36
63 0.31
64 0.3
65 0.27
66 0.25
67 0.23
68 0.25
69 0.22
70 0.21
71 0.18
72 0.16
73 0.12
74 0.13
75 0.14
76 0.12
77 0.16
78 0.2
79 0.27
80 0.28
81 0.3
82 0.31
83 0.32
84 0.35
85 0.4
86 0.4
87 0.38
88 0.43
89 0.49
90 0.55
91 0.65
92 0.67
93 0.69
94 0.73
95 0.72
96 0.72
97 0.68
98 0.65
99 0.63
100 0.6
101 0.53
102 0.44
103 0.4
104 0.36