Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5FVP4

Protein Details
Accession M5FVP4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
119-149TSSCSPSQAHSRRKPTPPRRRTSPARASQSLHydrophilic
NLS Segment(s)
PositionSequence
130-139RRKPTPPRRR
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSPNPLPTSPELPPKRSSNVVLPSSAPPVTPSVWPEAAARAASSSMPCMPSIPSNPSIPLIPLIPSMPLMPSIPSMPLMPSIPCIPTRCSNSKGPRTCISGGPSSLTSGISFFPGYSRTSSCSPSQAHSRRKPTPPRRRTSPARASQSLACSGPELGGGRTESRSTLSRWQGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.51
3 0.49
4 0.49
5 0.47
6 0.5
7 0.48
8 0.44
9 0.42
10 0.38
11 0.38
12 0.34
13 0.26
14 0.18
15 0.19
16 0.19
17 0.18
18 0.18
19 0.2
20 0.2
21 0.21
22 0.2
23 0.2
24 0.2
25 0.18
26 0.16
27 0.11
28 0.11
29 0.11
30 0.11
31 0.1
32 0.11
33 0.11
34 0.11
35 0.11
36 0.12
37 0.15
38 0.18
39 0.21
40 0.21
41 0.21
42 0.22
43 0.22
44 0.21
45 0.18
46 0.16
47 0.12
48 0.1
49 0.1
50 0.09
51 0.08
52 0.08
53 0.08
54 0.07
55 0.08
56 0.07
57 0.07
58 0.07
59 0.08
60 0.08
61 0.08
62 0.08
63 0.07
64 0.08
65 0.09
66 0.08
67 0.09
68 0.09
69 0.1
70 0.11
71 0.13
72 0.14
73 0.18
74 0.24
75 0.26
76 0.29
77 0.36
78 0.43
79 0.51
80 0.52
81 0.53
82 0.51
83 0.52
84 0.5
85 0.45
86 0.39
87 0.32
88 0.28
89 0.25
90 0.22
91 0.18
92 0.16
93 0.13
94 0.1
95 0.08
96 0.08
97 0.08
98 0.07
99 0.07
100 0.07
101 0.08
102 0.1
103 0.11
104 0.12
105 0.15
106 0.17
107 0.2
108 0.21
109 0.25
110 0.25
111 0.27
112 0.36
113 0.42
114 0.5
115 0.56
116 0.63
117 0.65
118 0.74
119 0.81
120 0.82
121 0.84
122 0.84
123 0.85
124 0.85
125 0.86
126 0.86
127 0.85
128 0.85
129 0.83
130 0.81
131 0.75
132 0.69
133 0.64
134 0.58
135 0.51
136 0.41
137 0.31
138 0.24
139 0.21
140 0.18
141 0.17
142 0.15
143 0.11
144 0.14
145 0.15
146 0.16
147 0.18
148 0.19
149 0.17
150 0.19
151 0.21
152 0.23
153 0.31