Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5FYV7

Protein Details
Accession M5FYV7    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-25AATSHPEHKSKPKQKKSERDVGKTLHydrophilic
NLS Segment(s)
PositionSequence
11-16KPKQKK
Subcellular Location(s) nucl 18.5, mito_nucl 12.5, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences AATSHPEHKSKPKQKKSERDVGKTLLPVARVQKILKADKEMSTCGKDAVFLISVAAEEFIKRLAQAGHQQAQRDKRSTVQQRDLGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.92
3 0.9
4 0.89
5 0.88
6 0.84
7 0.78
8 0.7
9 0.62
10 0.52
11 0.46
12 0.37
13 0.29
14 0.25
15 0.23
16 0.23
17 0.23
18 0.22
19 0.23
20 0.27
21 0.3
22 0.29
23 0.3
24 0.29
25 0.3
26 0.31
27 0.29
28 0.26
29 0.23
30 0.22
31 0.18
32 0.16
33 0.12
34 0.11
35 0.11
36 0.09
37 0.07
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.04
44 0.04
45 0.04
46 0.05
47 0.05
48 0.05
49 0.07
50 0.07
51 0.11
52 0.18
53 0.25
54 0.31
55 0.34
56 0.38
57 0.43
58 0.51
59 0.53
60 0.5
61 0.45
62 0.44
63 0.53
64 0.59
65 0.63
66 0.64