Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5FP99

Protein Details
Accession M5FP99    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
7-36SYHLDRRSKSGSKQKKRRKPALPTDKGKIPBasic
NLS Segment(s)
PositionSequence
12-41RRSKSGSKQKKRRKPALPTDKGKIPVARKS
Subcellular Location(s) nucl 19.5, mito_nucl 11.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MLGEVASYHLDRRSKSGSKQKKRRKPALPTDKGKIPVARKSGEAKDAGAVGEDVIQGAKRKLQETDAQEEPPTKQQRLEPPEPTVTDNPTLLVEVPPTEAQPPLTSQPIRDAREAVPPPPLLKHLTIGIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.45
3 0.55
4 0.61
5 0.69
6 0.79
7 0.85
8 0.87
9 0.92
10 0.93
11 0.92
12 0.91
13 0.91
14 0.92
15 0.91
16 0.86
17 0.81
18 0.76
19 0.7
20 0.62
21 0.57
22 0.5
23 0.47
24 0.45
25 0.41
26 0.38
27 0.4
28 0.39
29 0.37
30 0.33
31 0.26
32 0.22
33 0.21
34 0.18
35 0.13
36 0.1
37 0.07
38 0.06
39 0.06
40 0.05
41 0.04
42 0.05
43 0.06
44 0.06
45 0.08
46 0.09
47 0.1
48 0.11
49 0.14
50 0.19
51 0.22
52 0.27
53 0.26
54 0.25
55 0.25
56 0.25
57 0.24
58 0.26
59 0.26
60 0.21
61 0.22
62 0.26
63 0.34
64 0.41
65 0.46
66 0.41
67 0.41
68 0.44
69 0.43
70 0.42
71 0.35
72 0.29
73 0.25
74 0.22
75 0.19
76 0.16
77 0.15
78 0.12
79 0.11
80 0.09
81 0.07
82 0.1
83 0.09
84 0.1
85 0.1
86 0.1
87 0.11
88 0.12
89 0.14
90 0.15
91 0.21
92 0.21
93 0.21
94 0.3
95 0.37
96 0.39
97 0.37
98 0.38
99 0.33
100 0.43
101 0.44
102 0.36
103 0.33
104 0.32
105 0.32
106 0.31
107 0.33
108 0.27
109 0.26
110 0.28