Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5GFM0

Protein Details
Accession M5GFM0   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
96-122PPSPPRAVMRPKKVRRRGRPYPPQPSIHydrophilic
NLS Segment(s)
PositionSequence
99-115PPRAVMRPKKVRRRGRP
Subcellular Location(s) mito 12, nucl 8, cyto 6
Family & Domain DBs
Amino Acid Sequences MVAPPPAAPVPDWTPTTPFPLLPALSHPSSPSPFLTSPSPPALAASPNPSTSLPAPSTSPTPVTPGPPSLMPLLDFYGRAREWTAAARLSLEPSPPPSPPRAVMRPKKVRRRGRPYPPQPSIIIKAEPEEVSLHAAVVTPPAGLGLPMAPPSMRALEGELVAGTVVQEEDARLQRLLGDYERMLWERVESCERIERLIEDSARMFADR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.36
4 0.32
5 0.27
6 0.25
7 0.26
8 0.25
9 0.22
10 0.25
11 0.24
12 0.24
13 0.25
14 0.24
15 0.24
16 0.25
17 0.27
18 0.24
19 0.24
20 0.23
21 0.26
22 0.29
23 0.27
24 0.29
25 0.3
26 0.29
27 0.23
28 0.24
29 0.22
30 0.21
31 0.2
32 0.2
33 0.19
34 0.19
35 0.21
36 0.2
37 0.21
38 0.2
39 0.23
40 0.19
41 0.18
42 0.2
43 0.19
44 0.21
45 0.2
46 0.21
47 0.16
48 0.2
49 0.19
50 0.21
51 0.21
52 0.2
53 0.2
54 0.19
55 0.2
56 0.16
57 0.15
58 0.13
59 0.12
60 0.12
61 0.11
62 0.11
63 0.1
64 0.14
65 0.13
66 0.13
67 0.13
68 0.12
69 0.13
70 0.14
71 0.16
72 0.12
73 0.12
74 0.13
75 0.12
76 0.14
77 0.13
78 0.12
79 0.1
80 0.13
81 0.15
82 0.14
83 0.16
84 0.16
85 0.17
86 0.19
87 0.25
88 0.29
89 0.37
90 0.43
91 0.52
92 0.6
93 0.68
94 0.75
95 0.8
96 0.82
97 0.84
98 0.86
99 0.86
100 0.86
101 0.88
102 0.87
103 0.87
104 0.8
105 0.72
106 0.64
107 0.58
108 0.51
109 0.42
110 0.34
111 0.24
112 0.22
113 0.21
114 0.19
115 0.16
116 0.12
117 0.1
118 0.11
119 0.11
120 0.09
121 0.07
122 0.08
123 0.07
124 0.07
125 0.06
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.05
134 0.05
135 0.06
136 0.06
137 0.06
138 0.08
139 0.1
140 0.09
141 0.09
142 0.1
143 0.11
144 0.12
145 0.11
146 0.09
147 0.08
148 0.07
149 0.07
150 0.05
151 0.04
152 0.03
153 0.03
154 0.04
155 0.04
156 0.09
157 0.12
158 0.14
159 0.14
160 0.14
161 0.15
162 0.17
163 0.2
164 0.17
165 0.18
166 0.16
167 0.19
168 0.22
169 0.22
170 0.21
171 0.18
172 0.2
173 0.18
174 0.23
175 0.25
176 0.23
177 0.25
178 0.32
179 0.33
180 0.32
181 0.31
182 0.28
183 0.26
184 0.32
185 0.29
186 0.23
187 0.24
188 0.24