Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5GDK3

Protein Details
Accession M5GDK3    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
88-115MEESRGRGRGRERRRERRLLVRNPSPESBasic
NLS Segment(s)
PositionSequence
92-106RGRGRGRERRRERRL
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MTLEEYERAVDYLHEMNRLPPSPKVSPQTSFHVTRPPFSQSQSHTSPSSSSISLCSLDLPGSDTHSRSHSHCSGQASGVDGNCRRTQMEESRGRGRGRERRRERRLLVRNPSPESEEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.21
4 0.27
5 0.29
6 0.28
7 0.26
8 0.32
9 0.34
10 0.4
11 0.43
12 0.42
13 0.44
14 0.45
15 0.49
16 0.47
17 0.46
18 0.41
19 0.44
20 0.4
21 0.38
22 0.37
23 0.35
24 0.31
25 0.3
26 0.34
27 0.29
28 0.35
29 0.35
30 0.36
31 0.32
32 0.3
33 0.29
34 0.26
35 0.24
36 0.18
37 0.15
38 0.13
39 0.13
40 0.13
41 0.12
42 0.1
43 0.08
44 0.07
45 0.07
46 0.08
47 0.07
48 0.1
49 0.11
50 0.11
51 0.12
52 0.14
53 0.15
54 0.15
55 0.22
56 0.21
57 0.22
58 0.25
59 0.27
60 0.27
61 0.26
62 0.25
63 0.21
64 0.2
65 0.18
66 0.19
67 0.17
68 0.19
69 0.19
70 0.2
71 0.18
72 0.19
73 0.25
74 0.28
75 0.37
76 0.41
77 0.45
78 0.51
79 0.56
80 0.54
81 0.53
82 0.54
83 0.55
84 0.58
85 0.64
86 0.68
87 0.74
88 0.82
89 0.88
90 0.86
91 0.87
92 0.87
93 0.86
94 0.85
95 0.83
96 0.81
97 0.76
98 0.72