Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5G8C9

Protein Details
Accession M5G8C9    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
21-47QERQQQRKEADKRSRLRRKNVATRQPSHydrophilic
NLS Segment(s)
PositionSequence
32-39KRSRLRRK
Subcellular Location(s) cyto_nucl 10, mito 9, nucl 8, cyto 8
Family & Domain DBs
Amino Acid Sequences MDGRVLTVSGLLVLSPGGYEQERQQQRKEADKRSRLRRKNVATRQPSGTSSKVLESSPLVNVPGTMSLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.05
5 0.06
6 0.07
7 0.1
8 0.19
9 0.27
10 0.3
11 0.33
12 0.39
13 0.42
14 0.51
15 0.56
16 0.57
17 0.59
18 0.65
19 0.71
20 0.75
21 0.81
22 0.78
23 0.79
24 0.78
25 0.78
26 0.8
27 0.81
28 0.8
29 0.76
30 0.73
31 0.69
32 0.62
33 0.56
34 0.49
35 0.41
36 0.33
37 0.29
38 0.27
39 0.24
40 0.21
41 0.2
42 0.18
43 0.18
44 0.18
45 0.18
46 0.16
47 0.14
48 0.15
49 0.14