Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5G694

Protein Details
Accession M5G694   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
82-105AQDDAKGKKRKPKAKAKEVEQEQVHydrophilic
NLS Segment(s)
PositionSequence
87-98KGKKRKPKAKAK
Subcellular Location(s) mito 10.5, nucl 9.5, cyto_mito 8.833, cyto_nucl 8.333, cyto 6
Family & Domain DBs
Amino Acid Sequences MATAIVLRQLPAQEVPGACCFIAPRAKWVARGGNRQCPDTQERLGIVYKQICEKCPYLERYTDGWATKELIKQTLRNHQSKAQDDAKGKKRKPKAKAKEVEQEQVELGLELEVKEEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.19
4 0.2
5 0.18
6 0.17
7 0.16
8 0.17
9 0.23
10 0.2
11 0.23
12 0.29
13 0.31
14 0.33
15 0.37
16 0.42
17 0.42
18 0.52
19 0.53
20 0.54
21 0.55
22 0.54
23 0.5
24 0.46
25 0.45
26 0.39
27 0.35
28 0.28
29 0.26
30 0.26
31 0.26
32 0.22
33 0.19
34 0.17
35 0.16
36 0.2
37 0.2
38 0.2
39 0.22
40 0.22
41 0.23
42 0.26
43 0.29
44 0.26
45 0.26
46 0.28
47 0.27
48 0.28
49 0.28
50 0.23
51 0.2
52 0.18
53 0.18
54 0.18
55 0.18
56 0.16
57 0.19
58 0.2
59 0.23
60 0.27
61 0.35
62 0.39
63 0.4
64 0.42
65 0.43
66 0.49
67 0.49
68 0.51
69 0.46
70 0.46
71 0.48
72 0.54
73 0.58
74 0.6
75 0.61
76 0.63
77 0.68
78 0.71
79 0.77
80 0.79
81 0.8
82 0.81
83 0.87
84 0.85
85 0.86
86 0.82
87 0.79
88 0.69
89 0.6
90 0.49
91 0.4
92 0.32
93 0.22
94 0.16
95 0.09
96 0.09
97 0.07