Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074YSK7

Protein Details
Accession A0A074YSK7    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
72-103SKTVTKRASKRASKRAKNKANKKQKSGRAARSHydrophilic
NLS Segment(s)
PositionSequence
77-104KRASKRASKRAKNKANKKQKSGRAARSG
Subcellular Location(s) cyto 14.5, cyto_nucl 14.333, nucl 11, mito_nucl 6.999
Family & Domain DBs
Amino Acid Sequences MEQDVYLKNVVKVLLRFPGLVMEPSEIPGVDFQANGDGYSKFPFEDRDPVKPNYPYEKLRDLFALDDDREDSKTVTKRASKRASKRAKNKANKKQKSGRAARSGPRVDEEDDEEQLDENGGAVLDSQDLKLRGEDGEDGQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.24
4 0.22
5 0.24
6 0.21
7 0.21
8 0.19
9 0.16
10 0.15
11 0.16
12 0.16
13 0.12
14 0.11
15 0.1
16 0.11
17 0.1
18 0.09
19 0.08
20 0.11
21 0.11
22 0.11
23 0.12
24 0.1
25 0.11
26 0.13
27 0.13
28 0.09
29 0.1
30 0.13
31 0.14
32 0.23
33 0.25
34 0.31
35 0.36
36 0.39
37 0.43
38 0.43
39 0.44
40 0.41
41 0.43
42 0.38
43 0.38
44 0.43
45 0.39
46 0.37
47 0.34
48 0.28
49 0.23
50 0.22
51 0.19
52 0.12
53 0.12
54 0.12
55 0.12
56 0.12
57 0.12
58 0.1
59 0.12
60 0.15
61 0.17
62 0.21
63 0.27
64 0.31
65 0.41
66 0.5
67 0.54
68 0.6
69 0.69
70 0.75
71 0.78
72 0.83
73 0.84
74 0.85
75 0.87
76 0.89
77 0.89
78 0.9
79 0.88
80 0.87
81 0.85
82 0.83
83 0.83
84 0.82
85 0.79
86 0.77
87 0.76
88 0.73
89 0.72
90 0.67
91 0.57
92 0.51
93 0.45
94 0.38
95 0.34
96 0.33
97 0.26
98 0.24
99 0.23
100 0.21
101 0.18
102 0.16
103 0.14
104 0.09
105 0.06
106 0.05
107 0.05
108 0.04
109 0.04
110 0.05
111 0.06
112 0.06
113 0.07
114 0.11
115 0.12
116 0.13
117 0.14
118 0.14
119 0.13
120 0.15
121 0.17