Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074YGG8

Protein Details
Accession A0A074YGG8    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
70-92VTPPPRRGRGRPKKVLPDNKEPSBasic
105-126EDAPTPLPKKKAKKVNSEQADAHydrophilic
NLS Segment(s)
PositionSequence
73-102PPRRGRGRPKKVLPDNKEPSPSAKKTKKAL
110-118PLPKKKAKK
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MVATHLGKTKDAVRQRFMKLKKEVSDLAAGSVDAEDGGGTAAVAPAAATASTRKRKGKAAMLAEDDEDDVTPPPRRGRGRPKKVLPDNKEPSPSAKKTKKALTDEDAPTPLPKKKAKKVNSEQADADEDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.56
3 0.63
4 0.64
5 0.64
6 0.64
7 0.66
8 0.63
9 0.62
10 0.57
11 0.5
12 0.49
13 0.4
14 0.33
15 0.26
16 0.21
17 0.15
18 0.13
19 0.1
20 0.05
21 0.05
22 0.03
23 0.03
24 0.03
25 0.03
26 0.02
27 0.03
28 0.03
29 0.03
30 0.03
31 0.02
32 0.02
33 0.03
34 0.03
35 0.03
36 0.06
37 0.13
38 0.2
39 0.26
40 0.3
41 0.32
42 0.38
43 0.44
44 0.49
45 0.49
46 0.48
47 0.47
48 0.45
49 0.43
50 0.37
51 0.32
52 0.24
53 0.16
54 0.1
55 0.07
56 0.05
57 0.06
58 0.08
59 0.1
60 0.11
61 0.18
62 0.22
63 0.3
64 0.41
65 0.5
66 0.59
67 0.67
68 0.74
69 0.78
70 0.84
71 0.86
72 0.82
73 0.81
74 0.77
75 0.71
76 0.68
77 0.58
78 0.55
79 0.53
80 0.51
81 0.51
82 0.52
83 0.55
84 0.58
85 0.65
86 0.67
87 0.64
88 0.65
89 0.61
90 0.61
91 0.58
92 0.54
93 0.48
94 0.4
95 0.37
96 0.34
97 0.33
98 0.32
99 0.38
100 0.44
101 0.52
102 0.62
103 0.68
104 0.75
105 0.81
106 0.84
107 0.83
108 0.79
109 0.71
110 0.64