Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074ZR73

Protein Details
Accession A0A074ZR73    Localization Confidence High Confidence Score 20.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-36QAAPATHKQPSRKGKKAWRKNVDITELQHydrophilic
277-311DSEAVTKKRPERKTPSQRNKIKRRKELEHQAKWDKBasic
409-436LNGKLETRRTMQHKKPKREVTEKWSYKDHydrophilic
NLS Segment(s)
PositionSequence
18-27PSRKGKKAWR
283-316KKRPERKTPSQRNKIKRRKELEHQAKWDKQMKKK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011687  Nop53/GLTSCR2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0000027  P:ribosomal large subunit assembly  
Pfam View protein in Pfam  
PF07767  Nop53  
Amino Acid Sequences MAPVAEKVQAAPATHKQPSRKGKKAWRKNVDITELQEGVEDVREQIIQGGVLTERPAEQLFVSDVKGADDVQADFNKRHKPLKADEIIAQRSKVPAVDTRKRKSDGIATGSSKRSKNGTYVSHKDLQHLRSVANSGGAQSDIIKATESADHDPWGMEPIPQDPRFNFIPEKKAKVAPKTLKYAPISLAANGKPFAAVPKPSAGKSYNPTFEDWEAHVTKVGEREVAAERKRLEEAQEEHDRLEKALAEAARPEPSTDDEYQSAYESEWEGIQSEAEDSEAVTKKRPERKTPSQRNKIKRRKELEHQAKWDKQMKKKNEQLERVKEIALQLAEKERLLEEQKALQPASTGAEAEINDDDDTQLLRRRNLGRHAVPDAPLEVVLADELQDSLRALRPEGNLLKDRYRNMLLNGKLETRRTMQHKKPKREVTEKWSYKDWKLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.48
3 0.49
4 0.56
5 0.66
6 0.7
7 0.72
8 0.75
9 0.8
10 0.86
11 0.91
12 0.92
13 0.91
14 0.89
15 0.89
16 0.87
17 0.83
18 0.76
19 0.69
20 0.64
21 0.54
22 0.45
23 0.36
24 0.27
25 0.21
26 0.18
27 0.15
28 0.09
29 0.1
30 0.1
31 0.1
32 0.11
33 0.11
34 0.09
35 0.08
36 0.09
37 0.08
38 0.09
39 0.1
40 0.09
41 0.09
42 0.1
43 0.11
44 0.1
45 0.1
46 0.11
47 0.13
48 0.14
49 0.14
50 0.14
51 0.14
52 0.14
53 0.14
54 0.13
55 0.12
56 0.12
57 0.13
58 0.15
59 0.19
60 0.2
61 0.22
62 0.27
63 0.33
64 0.36
65 0.41
66 0.42
67 0.45
68 0.5
69 0.58
70 0.58
71 0.54
72 0.56
73 0.57
74 0.58
75 0.53
76 0.46
77 0.37
78 0.33
79 0.3
80 0.25
81 0.2
82 0.21
83 0.29
84 0.38
85 0.46
86 0.52
87 0.58
88 0.6
89 0.59
90 0.55
91 0.55
92 0.52
93 0.49
94 0.49
95 0.45
96 0.48
97 0.51
98 0.53
99 0.45
100 0.4
101 0.38
102 0.33
103 0.35
104 0.37
105 0.41
106 0.44
107 0.49
108 0.53
109 0.56
110 0.54
111 0.54
112 0.54
113 0.47
114 0.44
115 0.39
116 0.33
117 0.28
118 0.29
119 0.24
120 0.2
121 0.18
122 0.12
123 0.12
124 0.11
125 0.1
126 0.09
127 0.1
128 0.08
129 0.08
130 0.08
131 0.08
132 0.09
133 0.11
134 0.13
135 0.14
136 0.15
137 0.15
138 0.15
139 0.15
140 0.14
141 0.14
142 0.13
143 0.1
144 0.1
145 0.13
146 0.2
147 0.22
148 0.23
149 0.2
150 0.24
151 0.25
152 0.27
153 0.28
154 0.24
155 0.33
156 0.35
157 0.4
158 0.39
159 0.44
160 0.45
161 0.45
162 0.52
163 0.5
164 0.52
165 0.53
166 0.52
167 0.53
168 0.5
169 0.46
170 0.37
171 0.33
172 0.29
173 0.24
174 0.26
175 0.19
176 0.19
177 0.18
178 0.16
179 0.12
180 0.11
181 0.12
182 0.11
183 0.11
184 0.11
185 0.16
186 0.18
187 0.18
188 0.21
189 0.21
190 0.22
191 0.25
192 0.29
193 0.28
194 0.28
195 0.29
196 0.28
197 0.27
198 0.26
199 0.22
200 0.22
201 0.18
202 0.17
203 0.17
204 0.15
205 0.15
206 0.15
207 0.14
208 0.1
209 0.09
210 0.12
211 0.14
212 0.19
213 0.19
214 0.2
215 0.21
216 0.22
217 0.23
218 0.21
219 0.19
220 0.19
221 0.21
222 0.25
223 0.29
224 0.28
225 0.28
226 0.3
227 0.28
228 0.23
229 0.21
230 0.14
231 0.1
232 0.12
233 0.12
234 0.09
235 0.1
236 0.11
237 0.13
238 0.12
239 0.12
240 0.1
241 0.13
242 0.17
243 0.17
244 0.18
245 0.17
246 0.17
247 0.18
248 0.17
249 0.15
250 0.1
251 0.1
252 0.08
253 0.08
254 0.07
255 0.07
256 0.07
257 0.06
258 0.06
259 0.06
260 0.05
261 0.05
262 0.05
263 0.05
264 0.04
265 0.09
266 0.13
267 0.13
268 0.16
269 0.21
270 0.28
271 0.38
272 0.44
273 0.49
274 0.55
275 0.66
276 0.75
277 0.82
278 0.85
279 0.87
280 0.9
281 0.91
282 0.93
283 0.92
284 0.91
285 0.89
286 0.87
287 0.84
288 0.85
289 0.85
290 0.85
291 0.83
292 0.81
293 0.8
294 0.75
295 0.74
296 0.72
297 0.69
298 0.67
299 0.68
300 0.68
301 0.69
302 0.73
303 0.76
304 0.76
305 0.78
306 0.79
307 0.78
308 0.75
309 0.67
310 0.6
311 0.52
312 0.43
313 0.37
314 0.27
315 0.19
316 0.15
317 0.17
318 0.18
319 0.16
320 0.17
321 0.13
322 0.16
323 0.19
324 0.2
325 0.18
326 0.24
327 0.27
328 0.3
329 0.29
330 0.25
331 0.23
332 0.21
333 0.21
334 0.15
335 0.12
336 0.09
337 0.12
338 0.12
339 0.13
340 0.13
341 0.12
342 0.11
343 0.11
344 0.11
345 0.09
346 0.1
347 0.1
348 0.15
349 0.17
350 0.19
351 0.26
352 0.32
353 0.38
354 0.46
355 0.53
356 0.53
357 0.55
358 0.59
359 0.55
360 0.5
361 0.45
362 0.38
363 0.29
364 0.23
365 0.17
366 0.12
367 0.09
368 0.07
369 0.06
370 0.05
371 0.04
372 0.05
373 0.05
374 0.06
375 0.06
376 0.08
377 0.13
378 0.13
379 0.14
380 0.2
381 0.21
382 0.29
383 0.33
384 0.38
385 0.39
386 0.43
387 0.5
388 0.49
389 0.5
390 0.48
391 0.49
392 0.46
393 0.45
394 0.5
395 0.45
396 0.45
397 0.45
398 0.45
399 0.44
400 0.43
401 0.42
402 0.37
403 0.42
404 0.47
405 0.54
406 0.58
407 0.66
408 0.74
409 0.8
410 0.87
411 0.89
412 0.9
413 0.9
414 0.89
415 0.87
416 0.88
417 0.84
418 0.78
419 0.77
420 0.72