Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074YJI0

Protein Details
Accession A0A074YJI0    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
224-253SSSSDDSKKHHKRHSRSRSRSHSRNRGGYQBasic
NLS Segment(s)
PositionSequence
231-249KKHHKRHSRSRSRSHSRNR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR011058  Cyanovirin-N  
IPR036673  Cyanovirin-N_sf  
IPR008816  Gly_zipper_2TM_dom  
Gene Ontology GO:0019867  C:outer membrane  
Pfam View protein in Pfam  
PF08881  CVNH  
PF05433  Rick_17kDa_Anti  
Amino Acid Sequences MSYNNYNSHSGEAQGYYGGGQQQQQQGYGSEAPPNQYGSEARYGGPQQHNNQYGGSQQHDSQYGGPQQSQYGNEQRYGSPPQHDQGYGGYQPQQQSYGQPQQPLTARDEYPSQTHGGYGGNTSYQGSESAPYAPAQPSYGGQAGVEGDRGMMGALAGGAAGAYGGHKMNHGIIGAIGGAFAGSKLEDFGKDHKKKKDEEKYAQQQGYGASGNYGRPSRRDSSSSSSSDDSKKHHKRHSRSRSRSHSRNRGGYQTSRRGNFSESCRDISIDYNTMALKALCRRTDGSEHESYLHLNDVLGNHDGRFVWGRGGNFAGSVKEGKIWLAEGGRALCAVLGDGRGGWNEHASIELDEKISNENGQLTFLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.13
4 0.14
5 0.14
6 0.13
7 0.15
8 0.2
9 0.26
10 0.27
11 0.28
12 0.27
13 0.26
14 0.28
15 0.29
16 0.25
17 0.24
18 0.25
19 0.26
20 0.27
21 0.27
22 0.23
23 0.22
24 0.22
25 0.2
26 0.25
27 0.23
28 0.22
29 0.26
30 0.27
31 0.33
32 0.4
33 0.43
34 0.43
35 0.51
36 0.54
37 0.5
38 0.49
39 0.42
40 0.38
41 0.35
42 0.33
43 0.26
44 0.24
45 0.26
46 0.27
47 0.27
48 0.24
49 0.26
50 0.28
51 0.28
52 0.27
53 0.25
54 0.25
55 0.28
56 0.28
57 0.28
58 0.31
59 0.31
60 0.33
61 0.34
62 0.32
63 0.33
64 0.36
65 0.33
66 0.3
67 0.31
68 0.31
69 0.32
70 0.31
71 0.28
72 0.26
73 0.27
74 0.23
75 0.22
76 0.23
77 0.23
78 0.24
79 0.24
80 0.24
81 0.19
82 0.22
83 0.28
84 0.34
85 0.33
86 0.35
87 0.34
88 0.37
89 0.4
90 0.39
91 0.36
92 0.31
93 0.29
94 0.27
95 0.29
96 0.27
97 0.25
98 0.24
99 0.21
100 0.16
101 0.16
102 0.15
103 0.13
104 0.12
105 0.1
106 0.09
107 0.08
108 0.09
109 0.09
110 0.08
111 0.07
112 0.08
113 0.07
114 0.08
115 0.08
116 0.09
117 0.09
118 0.09
119 0.11
120 0.11
121 0.11
122 0.11
123 0.11
124 0.1
125 0.12
126 0.13
127 0.11
128 0.1
129 0.1
130 0.1
131 0.09
132 0.09
133 0.06
134 0.05
135 0.04
136 0.05
137 0.04
138 0.03
139 0.03
140 0.02
141 0.02
142 0.02
143 0.02
144 0.02
145 0.02
146 0.01
147 0.02
148 0.02
149 0.02
150 0.03
151 0.04
152 0.04
153 0.04
154 0.05
155 0.06
156 0.06
157 0.06
158 0.05
159 0.05
160 0.05
161 0.05
162 0.04
163 0.04
164 0.03
165 0.02
166 0.02
167 0.02
168 0.02
169 0.02
170 0.02
171 0.03
172 0.03
173 0.04
174 0.06
175 0.13
176 0.23
177 0.31
178 0.38
179 0.44
180 0.48
181 0.53
182 0.63
183 0.67
184 0.66
185 0.67
186 0.71
187 0.74
188 0.77
189 0.71
190 0.61
191 0.51
192 0.41
193 0.35
194 0.25
195 0.15
196 0.09
197 0.09
198 0.1
199 0.11
200 0.13
201 0.12
202 0.14
203 0.19
204 0.22
205 0.24
206 0.27
207 0.29
208 0.34
209 0.4
210 0.4
211 0.37
212 0.35
213 0.35
214 0.36
215 0.33
216 0.31
217 0.36
218 0.43
219 0.48
220 0.56
221 0.63
222 0.69
223 0.78
224 0.85
225 0.85
226 0.86
227 0.88
228 0.9
229 0.9
230 0.9
231 0.89
232 0.89
233 0.85
234 0.84
235 0.77
236 0.73
237 0.69
238 0.67
239 0.65
240 0.64
241 0.62
242 0.55
243 0.54
244 0.48
245 0.47
246 0.44
247 0.41
248 0.42
249 0.39
250 0.39
251 0.38
252 0.37
253 0.34
254 0.32
255 0.29
256 0.21
257 0.19
258 0.18
259 0.17
260 0.16
261 0.16
262 0.13
263 0.13
264 0.17
265 0.23
266 0.22
267 0.25
268 0.27
269 0.31
270 0.37
271 0.4
272 0.4
273 0.38
274 0.38
275 0.37
276 0.35
277 0.31
278 0.26
279 0.21
280 0.15
281 0.11
282 0.11
283 0.1
284 0.12
285 0.14
286 0.13
287 0.12
288 0.13
289 0.13
290 0.14
291 0.17
292 0.15
293 0.18
294 0.2
295 0.21
296 0.21
297 0.23
298 0.21
299 0.18
300 0.19
301 0.15
302 0.14
303 0.15
304 0.13
305 0.13
306 0.14
307 0.13
308 0.13
309 0.13
310 0.14
311 0.14
312 0.14
313 0.15
314 0.16
315 0.16
316 0.15
317 0.13
318 0.11
319 0.09
320 0.09
321 0.07
322 0.07
323 0.07
324 0.07
325 0.09
326 0.1
327 0.11
328 0.11
329 0.12
330 0.12
331 0.12
332 0.13
333 0.14
334 0.14
335 0.15
336 0.16
337 0.15
338 0.15
339 0.16
340 0.17
341 0.17
342 0.16
343 0.15
344 0.18
345 0.17