Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074YQH8

Protein Details
Accession A0A074YQH8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
64-86DIVAKQKEWKRDNKTPPPLRSVRHydrophilic
NLS Segment(s)
PositionSequence
44-58EKKGRKKVPPKRGRE
68-91KQKEWKRDNKTPPPLRSVRSRMKK
Subcellular Location(s) nucl 17, mito_nucl 12.833, cyto_nucl 9.833, mito 7.5
Family & Domain DBs
Amino Acid Sequences MRDWTWRRGSPRRPFRLSGHKTVELAKQELKYKTLEFKHIALQEKKGRKKVPPKRGRELVDAEDIVAKQKEWKRDNKTPPPLRSVRSRMKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.76
3 0.78
4 0.74
5 0.72
6 0.68
7 0.61
8 0.56
9 0.55
10 0.52
11 0.44
12 0.4
13 0.34
14 0.3
15 0.34
16 0.34
17 0.32
18 0.29
19 0.27
20 0.32
21 0.31
22 0.33
23 0.29
24 0.29
25 0.33
26 0.35
27 0.4
28 0.34
29 0.38
30 0.4
31 0.46
32 0.5
33 0.5
34 0.5
35 0.51
36 0.6
37 0.64
38 0.68
39 0.7
40 0.73
41 0.75
42 0.8
43 0.76
44 0.71
45 0.65
46 0.57
47 0.51
48 0.43
49 0.34
50 0.27
51 0.23
52 0.2
53 0.16
54 0.12
55 0.17
56 0.21
57 0.3
58 0.35
59 0.45
60 0.52
61 0.62
62 0.73
63 0.76
64 0.83
65 0.83
66 0.82
67 0.81
68 0.78
69 0.72
70 0.71
71 0.7