Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7EJV6

Protein Details
Accession A7EJV6    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPKNKGKGGKNRRRGKNENDNEKRELBasic
NLS Segment(s)
PositionSequence
3-16KNKGKGGKNRRRGK
Subcellular Location(s) nucl 18, mito 6, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006196  RNA-binding_domain_S1_IF1  
IPR001253  TIF_eIF-1A  
IPR018104  TIF_eIF-1A_CS  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0003725  F:double-stranded RNA binding  
GO:0033592  F:RNA strand annealing activity  
GO:0003743  F:translation initiation factor activity  
GO:0006413  P:translational initiation  
KEGG ssl:SS1G_05601  -  
Pfam View protein in Pfam  
PF01176  eIF-1a  
PROSITE View protein in PROSITE  
PS01262  IF1A  
PS50832  S1_IF1_TYPE  
CDD cd05793  S1_IF1A  
Amino Acid Sequences MPKNKGKGGKNRRRGKNENDNEKRELTFKEEGQEYAQVIKMLGNGRLEALCFDGTRRLAHIRGKLRKKVWINQGDIILLSLRDYQDEKGDVILKYSADEARSLKAYGELPESAKINETDTYGQGEDGDCNFEFDDDRDSGSDSDDAADGGKGKEIDIDDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.88
4 0.87
5 0.88
6 0.87
7 0.82
8 0.76
9 0.7
10 0.61
11 0.53
12 0.44
13 0.39
14 0.34
15 0.3
16 0.31
17 0.3
18 0.3
19 0.29
20 0.29
21 0.23
22 0.2
23 0.2
24 0.15
25 0.14
26 0.13
27 0.14
28 0.14
29 0.15
30 0.14
31 0.13
32 0.14
33 0.14
34 0.13
35 0.11
36 0.11
37 0.09
38 0.08
39 0.09
40 0.12
41 0.13
42 0.13
43 0.15
44 0.16
45 0.18
46 0.23
47 0.3
48 0.36
49 0.44
50 0.52
51 0.56
52 0.56
53 0.6
54 0.61
55 0.61
56 0.62
57 0.6
58 0.55
59 0.51
60 0.49
61 0.41
62 0.35
63 0.28
64 0.18
65 0.1
66 0.07
67 0.06
68 0.05
69 0.06
70 0.07
71 0.07
72 0.09
73 0.1
74 0.1
75 0.1
76 0.13
77 0.12
78 0.12
79 0.12
80 0.11
81 0.1
82 0.12
83 0.11
84 0.09
85 0.1
86 0.1
87 0.11
88 0.13
89 0.13
90 0.11
91 0.13
92 0.14
93 0.13
94 0.15
95 0.15
96 0.15
97 0.16
98 0.17
99 0.15
100 0.15
101 0.14
102 0.14
103 0.13
104 0.14
105 0.14
106 0.14
107 0.17
108 0.15
109 0.15
110 0.13
111 0.13
112 0.12
113 0.11
114 0.14
115 0.11
116 0.12
117 0.12
118 0.12
119 0.12
120 0.12
121 0.15
122 0.12
123 0.14
124 0.13
125 0.15
126 0.15
127 0.16
128 0.16
129 0.11
130 0.12
131 0.11
132 0.1
133 0.09
134 0.1
135 0.09
136 0.09
137 0.12
138 0.11
139 0.11
140 0.15