Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7EG44

Protein Details
Accession A7EG44    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
57-79QAYRDCKKQWIEQRKEAKRKAGWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 7, cyto 2, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0033108  P:mitochondrial respiratory chain complex assembly  
KEGG ssl:SS1G_04285  -  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSSDKSTDNPWNQETSQKFESKRPGEYFDPCQEAASRSLKCLARNGGDRDMCTDYFQAYRDCKKQWIEQRKEAKRKAGWFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.43
3 0.42
4 0.42
5 0.42
6 0.43
7 0.52
8 0.48
9 0.52
10 0.48
11 0.48
12 0.46
13 0.49
14 0.49
15 0.43
16 0.43
17 0.35
18 0.33
19 0.28
20 0.26
21 0.25
22 0.24
23 0.2
24 0.17
25 0.23
26 0.24
27 0.24
28 0.26
29 0.25
30 0.24
31 0.29
32 0.32
33 0.33
34 0.32
35 0.31
36 0.32
37 0.32
38 0.28
39 0.24
40 0.21
41 0.16
42 0.16
43 0.17
44 0.18
45 0.2
46 0.26
47 0.29
48 0.31
49 0.36
50 0.39
51 0.47
52 0.53
53 0.6
54 0.62
55 0.67
56 0.76
57 0.8
58 0.86
59 0.83
60 0.82
61 0.78