Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074YA36

Protein Details
Accession A0A074YA36    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
166-191DGKTSKAPKKTIRPRKTPVKPPKAAVHydrophilic
NLS Segment(s)
PositionSequence
85-106PKTPKTPKTPKGKGGRPPKRKA
170-188SKAPKKTIRPRKTPVKPPK
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 7
Family & Domain DBs
Amino Acid Sequences MSYSYAIAKEVLSDGEKDRILAIFLSSDDNNDVNWDKATQAFGAASVESMKVSYRNLLKKIEKAGGKTGVTAPSANSDSAAPSAPKTPKTPKTPKGKGGRPPKRKAEAAESDDDEDSDAPKTLRKKAAKNAAKAGDDGEDEDAPKSVLKRATKKTVSRTEDGDSDDGKTSKAPKKTIRPRKTPVKPPKAAVGQIVNGGGEATDSVSGNIESVQEDGEASKMVNDEDGSEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.2
3 0.2
4 0.19
5 0.19
6 0.17
7 0.17
8 0.15
9 0.13
10 0.09
11 0.1
12 0.14
13 0.12
14 0.13
15 0.14
16 0.14
17 0.13
18 0.16
19 0.17
20 0.14
21 0.15
22 0.14
23 0.13
24 0.14
25 0.16
26 0.12
27 0.12
28 0.11
29 0.1
30 0.11
31 0.1
32 0.09
33 0.08
34 0.08
35 0.07
36 0.07
37 0.07
38 0.08
39 0.09
40 0.14
41 0.2
42 0.26
43 0.3
44 0.38
45 0.41
46 0.44
47 0.48
48 0.49
49 0.45
50 0.42
51 0.44
52 0.42
53 0.38
54 0.35
55 0.32
56 0.28
57 0.26
58 0.24
59 0.18
60 0.16
61 0.18
62 0.16
63 0.14
64 0.11
65 0.11
66 0.12
67 0.13
68 0.09
69 0.09
70 0.15
71 0.17
72 0.19
73 0.23
74 0.31
75 0.38
76 0.47
77 0.56
78 0.59
79 0.67
80 0.71
81 0.75
82 0.76
83 0.75
84 0.74
85 0.76
86 0.79
87 0.78
88 0.78
89 0.78
90 0.75
91 0.7
92 0.64
93 0.61
94 0.57
95 0.51
96 0.46
97 0.39
98 0.34
99 0.31
100 0.28
101 0.2
102 0.13
103 0.09
104 0.07
105 0.07
106 0.05
107 0.09
108 0.11
109 0.16
110 0.25
111 0.29
112 0.35
113 0.42
114 0.53
115 0.56
116 0.58
117 0.59
118 0.56
119 0.51
120 0.46
121 0.39
122 0.29
123 0.23
124 0.2
125 0.14
126 0.1
127 0.09
128 0.09
129 0.08
130 0.07
131 0.08
132 0.08
133 0.1
134 0.16
135 0.22
136 0.3
137 0.36
138 0.46
139 0.52
140 0.58
141 0.63
142 0.68
143 0.67
144 0.61
145 0.58
146 0.51
147 0.46
148 0.43
149 0.36
150 0.26
151 0.23
152 0.23
153 0.2
154 0.17
155 0.17
156 0.22
157 0.26
158 0.32
159 0.36
160 0.42
161 0.53
162 0.64
163 0.74
164 0.76
165 0.79
166 0.82
167 0.86
168 0.88
169 0.88
170 0.88
171 0.87
172 0.82
173 0.76
174 0.76
175 0.71
176 0.63
177 0.56
178 0.49
179 0.39
180 0.36
181 0.33
182 0.24
183 0.18
184 0.16
185 0.11
186 0.07
187 0.06
188 0.05
189 0.05
190 0.06
191 0.06
192 0.08
193 0.08
194 0.08
195 0.08
196 0.08
197 0.08
198 0.08
199 0.08
200 0.07
201 0.08
202 0.08
203 0.08
204 0.08
205 0.07
206 0.09
207 0.09
208 0.09
209 0.1
210 0.1