Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074YCP6

Protein Details
Accession A0A074YCP6   
Localization Confidence High
Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
67-96TEEDQEKKKEKNKKKYLRKKEKAQAEKAQABasic
145-169TDAPQPKLSKRQKKTLLKKSKQAQAHydrophilic
NLS Segment(s)
PositionSequence
73-93KKKEKNKKKYLRKKEKAQAEK
154-158KRQKK
Subcellular Location(s) nucl 20.5, mito_nucl 11.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MASFQGVPIEKIREHFMREEFRNEMFDNMVVDCIDGNSGLLFGQPPIPPEQRIQELDSDEEPAADPTEEDQEKKKEKNKKKYLRKKEKAQAEKAQAEKDELLRRLSELREPAMKRIAALSIKDKEAASSASPASINPGVNTATDTDAPQPKLSKRQKKTLLKKSKQAQAAASESETAGSLTDGSLATKPKQKDTESRHVKSEAARVELSKEGSKALDVDSKKQRSGKGVLKESEAEVEDVMATVAKRFGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.38
4 0.43
5 0.45
6 0.48
7 0.45
8 0.43
9 0.43
10 0.39
11 0.33
12 0.26
13 0.23
14 0.19
15 0.16
16 0.16
17 0.11
18 0.11
19 0.09
20 0.08
21 0.07
22 0.06
23 0.06
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.1
31 0.1
32 0.12
33 0.18
34 0.21
35 0.22
36 0.25
37 0.29
38 0.3
39 0.32
40 0.32
41 0.3
42 0.29
43 0.3
44 0.28
45 0.25
46 0.2
47 0.17
48 0.16
49 0.13
50 0.12
51 0.09
52 0.09
53 0.07
54 0.14
55 0.14
56 0.15
57 0.2
58 0.26
59 0.32
60 0.38
61 0.44
62 0.48
63 0.58
64 0.68
65 0.75
66 0.79
67 0.85
68 0.9
69 0.94
70 0.95
71 0.94
72 0.93
73 0.9
74 0.9
75 0.88
76 0.85
77 0.81
78 0.77
79 0.73
80 0.65
81 0.58
82 0.48
83 0.41
84 0.34
85 0.3
86 0.28
87 0.24
88 0.22
89 0.2
90 0.21
91 0.22
92 0.21
93 0.2
94 0.16
95 0.17
96 0.22
97 0.23
98 0.24
99 0.26
100 0.25
101 0.21
102 0.2
103 0.21
104 0.16
105 0.16
106 0.19
107 0.17
108 0.18
109 0.19
110 0.18
111 0.15
112 0.14
113 0.14
114 0.1
115 0.09
116 0.09
117 0.09
118 0.09
119 0.08
120 0.11
121 0.12
122 0.11
123 0.09
124 0.11
125 0.1
126 0.1
127 0.11
128 0.09
129 0.08
130 0.09
131 0.09
132 0.12
133 0.16
134 0.17
135 0.18
136 0.2
137 0.21
138 0.31
139 0.41
140 0.47
141 0.48
142 0.57
143 0.67
144 0.74
145 0.83
146 0.83
147 0.85
148 0.81
149 0.84
150 0.82
151 0.79
152 0.73
153 0.65
154 0.56
155 0.5
156 0.46
157 0.39
158 0.31
159 0.24
160 0.19
161 0.17
162 0.14
163 0.09
164 0.06
165 0.05
166 0.05
167 0.04
168 0.05
169 0.05
170 0.06
171 0.09
172 0.11
173 0.14
174 0.2
175 0.22
176 0.28
177 0.34
178 0.37
179 0.45
180 0.52
181 0.6
182 0.64
183 0.65
184 0.62
185 0.58
186 0.56
187 0.5
188 0.48
189 0.41
190 0.35
191 0.33
192 0.29
193 0.31
194 0.31
195 0.31
196 0.26
197 0.22
198 0.19
199 0.19
200 0.19
201 0.17
202 0.16
203 0.2
204 0.2
205 0.28
206 0.37
207 0.4
208 0.45
209 0.48
210 0.49
211 0.48
212 0.55
213 0.55
214 0.56
215 0.6
216 0.57
217 0.57
218 0.55
219 0.49
220 0.45
221 0.37
222 0.28
223 0.19
224 0.17
225 0.14
226 0.12
227 0.11
228 0.08
229 0.07
230 0.07