Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074Y7W6

Protein Details
Accession A0A074Y7W6    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
72-110DPSHRVRKRRSGFLARLRTRTGRNLLKRRRLKKRSTLSHBasic
NLS Segment(s)
PositionSequence
75-106HRVRKRRSGFLARLRTRTGRNLLKRRRLKKRS
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MSLLQSTLRPLAASQPAQSRTFSLLSARRPTLPSTPTSTLSLNTTLELPTLPAASTTLTLLQARGPKRDTFDPSHRVRKRRSGFLARLRTRTGRNLLKRRRLKKRSTLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.35
4 0.36
5 0.36
6 0.32
7 0.29
8 0.28
9 0.25
10 0.24
11 0.25
12 0.3
13 0.35
14 0.35
15 0.34
16 0.34
17 0.37
18 0.36
19 0.33
20 0.31
21 0.32
22 0.33
23 0.33
24 0.33
25 0.31
26 0.26
27 0.25
28 0.24
29 0.17
30 0.15
31 0.13
32 0.1
33 0.1
34 0.09
35 0.07
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.06
45 0.06
46 0.07
47 0.07
48 0.09
49 0.14
50 0.15
51 0.18
52 0.2
53 0.2
54 0.25
55 0.29
56 0.32
57 0.35
58 0.41
59 0.45
60 0.5
61 0.59
62 0.61
63 0.63
64 0.64
65 0.67
66 0.66
67 0.68
68 0.7
69 0.69
70 0.72
71 0.76
72 0.81
73 0.75
74 0.73
75 0.68
76 0.64
77 0.58
78 0.56
79 0.55
80 0.54
81 0.6
82 0.66
83 0.72
84 0.78
85 0.84
86 0.87
87 0.9
88 0.9
89 0.89
90 0.89