Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074Y7W0

Protein Details
Accession A0A074Y7W0   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
557-583PKSPSGKILRRLLRDKEKEKRRAAGAKBasic
NLS Segment(s)
PositionSequence
559-584SPSGKILRRLLRDKEKEKRRAAGAKL
Subcellular Location(s) cyto 17, cyto_nucl 13.5, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR025110  AMP-bd_C  
IPR045851  AMP-bd_C_sf  
IPR020845  AMP-binding_CS  
IPR000873  AMP-dep_Synth/Lig_com  
Pfam View protein in Pfam  
PF00501  AMP-binding  
PF13193  AMP-binding_C  
PROSITE View protein in PROSITE  
PS00455  AMP_BINDING  
CDD cd05911  Firefly_Luc_like  
Amino Acid Sequences MPFYAPNWVPKLPFEIPDSISVDKFILDENFDRHPLGYSRPPFICGITGKEYSALEVKERVDFLARGLSNELGFHPNQGSEWDKVIGLFSINTIDTLTLAWATHRIGGIQTPANAAYTVQELEHQLRDSGAKCLFTCSPLLDLALQAAKSVGIAENRIFLLDVPQAVAGKKRDGYKTLDQLIDQGQKLAKIEGLEWSKGEGARRTAFLCYSSGTSGLPKGVMISHKNVIANVLQMRAFEDPWRKTLIEPGNQSDYTENVLGLLPLNHIYALIVVAHLGAYRGDGVVVLPKFEFKSFLETIQTHKISNLYLVPPIIITITKSRDVVKQYDLSSVKSIFTGAAPLGEETAQDLQSMFPTWAIRQGYGMTESATVVCSTIPSDVYFGSSGSLLPGIEARIVTPEGEEITEYDTPGELIVKGPAVTLGYLNNQKATDETFVDGYLRTGDEAVVRKHPKSGHEHIFIVDRLKELIKVKGLQVAPAELEAHLLTHPAVNDCVVIGVPSDREGEVPKAFVVKSPSVGLEESDRMVARDIARHVEQHKAKHKWLKGGIEFIDIVPKSPSGKILRRLLRDKEKEKRRAAGAKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.34
4 0.37
5 0.39
6 0.34
7 0.31
8 0.28
9 0.24
10 0.19
11 0.18
12 0.16
13 0.13
14 0.15
15 0.18
16 0.2
17 0.23
18 0.24
19 0.25
20 0.23
21 0.25
22 0.24
23 0.28
24 0.34
25 0.34
26 0.4
27 0.4
28 0.42
29 0.39
30 0.38
31 0.37
32 0.3
33 0.32
34 0.31
35 0.31
36 0.29
37 0.3
38 0.28
39 0.25
40 0.28
41 0.23
42 0.19
43 0.22
44 0.23
45 0.23
46 0.24
47 0.22
48 0.22
49 0.21
50 0.2
51 0.25
52 0.24
53 0.22
54 0.24
55 0.24
56 0.2
57 0.21
58 0.22
59 0.17
60 0.17
61 0.18
62 0.17
63 0.16
64 0.16
65 0.19
66 0.2
67 0.18
68 0.2
69 0.19
70 0.18
71 0.18
72 0.18
73 0.15
74 0.12
75 0.1
76 0.08
77 0.1
78 0.09
79 0.09
80 0.09
81 0.08
82 0.08
83 0.08
84 0.08
85 0.06
86 0.06
87 0.07
88 0.08
89 0.09
90 0.11
91 0.11
92 0.11
93 0.11
94 0.13
95 0.16
96 0.17
97 0.17
98 0.16
99 0.16
100 0.16
101 0.16
102 0.14
103 0.11
104 0.1
105 0.1
106 0.09
107 0.1
108 0.12
109 0.15
110 0.17
111 0.17
112 0.15
113 0.16
114 0.18
115 0.18
116 0.2
117 0.19
118 0.19
119 0.18
120 0.22
121 0.22
122 0.21
123 0.21
124 0.17
125 0.17
126 0.15
127 0.16
128 0.12
129 0.11
130 0.12
131 0.12
132 0.11
133 0.09
134 0.09
135 0.08
136 0.07
137 0.08
138 0.08
139 0.08
140 0.1
141 0.1
142 0.12
143 0.12
144 0.12
145 0.11
146 0.09
147 0.11
148 0.11
149 0.11
150 0.09
151 0.1
152 0.11
153 0.11
154 0.16
155 0.14
156 0.16
157 0.2
158 0.24
159 0.27
160 0.29
161 0.36
162 0.39
163 0.44
164 0.46
165 0.43
166 0.38
167 0.37
168 0.39
169 0.36
170 0.29
171 0.24
172 0.2
173 0.2
174 0.2
175 0.19
176 0.15
177 0.11
178 0.11
179 0.15
180 0.18
181 0.17
182 0.17
183 0.17
184 0.17
185 0.18
186 0.2
187 0.17
188 0.18
189 0.19
190 0.21
191 0.21
192 0.2
193 0.2
194 0.18
195 0.16
196 0.13
197 0.13
198 0.12
199 0.12
200 0.11
201 0.11
202 0.11
203 0.1
204 0.09
205 0.07
206 0.07
207 0.09
208 0.12
209 0.13
210 0.16
211 0.17
212 0.19
213 0.2
214 0.19
215 0.19
216 0.15
217 0.16
218 0.13
219 0.13
220 0.11
221 0.11
222 0.12
223 0.12
224 0.12
225 0.13
226 0.2
227 0.2
228 0.21
229 0.24
230 0.23
231 0.22
232 0.3
233 0.33
234 0.32
235 0.33
236 0.34
237 0.36
238 0.35
239 0.36
240 0.28
241 0.22
242 0.18
243 0.15
244 0.12
245 0.08
246 0.08
247 0.07
248 0.07
249 0.07
250 0.05
251 0.05
252 0.06
253 0.05
254 0.05
255 0.05
256 0.05
257 0.04
258 0.04
259 0.03
260 0.03
261 0.03
262 0.03
263 0.03
264 0.03
265 0.03
266 0.03
267 0.03
268 0.03
269 0.03
270 0.03
271 0.03
272 0.08
273 0.08
274 0.08
275 0.08
276 0.09
277 0.1
278 0.1
279 0.12
280 0.08
281 0.15
282 0.15
283 0.16
284 0.18
285 0.18
286 0.21
287 0.26
288 0.26
289 0.2
290 0.2
291 0.2
292 0.16
293 0.17
294 0.16
295 0.1
296 0.1
297 0.1
298 0.09
299 0.08
300 0.08
301 0.07
302 0.05
303 0.06
304 0.09
305 0.11
306 0.12
307 0.14
308 0.15
309 0.19
310 0.22
311 0.23
312 0.23
313 0.24
314 0.24
315 0.3
316 0.3
317 0.27
318 0.26
319 0.24
320 0.21
321 0.17
322 0.17
323 0.1
324 0.09
325 0.08
326 0.06
327 0.06
328 0.06
329 0.06
330 0.06
331 0.06
332 0.06
333 0.06
334 0.08
335 0.07
336 0.07
337 0.07
338 0.07
339 0.07
340 0.08
341 0.07
342 0.07
343 0.07
344 0.08
345 0.13
346 0.14
347 0.13
348 0.13
349 0.14
350 0.14
351 0.15
352 0.15
353 0.1
354 0.09
355 0.09
356 0.09
357 0.09
358 0.07
359 0.06
360 0.06
361 0.05
362 0.05
363 0.06
364 0.06
365 0.06
366 0.07
367 0.07
368 0.09
369 0.09
370 0.08
371 0.08
372 0.07
373 0.07
374 0.06
375 0.07
376 0.05
377 0.05
378 0.06
379 0.06
380 0.06
381 0.06
382 0.06
383 0.07
384 0.08
385 0.08
386 0.07
387 0.07
388 0.07
389 0.07
390 0.07
391 0.06
392 0.09
393 0.1
394 0.1
395 0.09
396 0.09
397 0.09
398 0.09
399 0.09
400 0.05
401 0.06
402 0.06
403 0.07
404 0.07
405 0.07
406 0.07
407 0.07
408 0.07
409 0.07
410 0.08
411 0.12
412 0.16
413 0.17
414 0.18
415 0.18
416 0.18
417 0.18
418 0.19
419 0.17
420 0.14
421 0.15
422 0.13
423 0.13
424 0.14
425 0.13
426 0.11
427 0.1
428 0.08
429 0.07
430 0.07
431 0.07
432 0.11
433 0.15
434 0.17
435 0.25
436 0.28
437 0.28
438 0.33
439 0.35
440 0.37
441 0.42
442 0.48
443 0.48
444 0.49
445 0.5
446 0.47
447 0.48
448 0.43
449 0.37
450 0.29
451 0.21
452 0.18
453 0.18
454 0.21
455 0.19
456 0.23
457 0.24
458 0.25
459 0.26
460 0.31
461 0.31
462 0.29
463 0.28
464 0.24
465 0.2
466 0.19
467 0.19
468 0.11
469 0.13
470 0.1
471 0.09
472 0.08
473 0.08
474 0.07
475 0.08
476 0.09
477 0.1
478 0.1
479 0.1
480 0.1
481 0.09
482 0.1
483 0.08
484 0.07
485 0.06
486 0.07
487 0.07
488 0.08
489 0.1
490 0.1
491 0.11
492 0.14
493 0.18
494 0.18
495 0.18
496 0.17
497 0.19
498 0.19
499 0.21
500 0.25
501 0.22
502 0.23
503 0.24
504 0.24
505 0.23
506 0.24
507 0.22
508 0.2
509 0.2
510 0.18
511 0.19
512 0.18
513 0.16
514 0.18
515 0.2
516 0.17
517 0.21
518 0.23
519 0.26
520 0.27
521 0.31
522 0.32
523 0.38
524 0.41
525 0.46
526 0.54
527 0.55
528 0.62
529 0.67
530 0.71
531 0.71
532 0.73
533 0.73
534 0.67
535 0.68
536 0.61
537 0.55
538 0.5
539 0.4
540 0.41
541 0.31
542 0.28
543 0.22
544 0.22
545 0.21
546 0.21
547 0.28
548 0.29
549 0.37
550 0.45
551 0.53
552 0.6
553 0.67
554 0.74
555 0.76
556 0.79
557 0.81
558 0.82
559 0.83
560 0.85
561 0.86
562 0.85
563 0.83
564 0.81