Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074Z385

Protein Details
Accession A0A074Z385    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
94-127SQDPGWNEKERKKERKKERKRERKKESNTGTCDVBasic
NLS Segment(s)
PositionSequence
102-118KERKKERKKERKRERKK
Subcellular Location(s) mito 12.5, cyto_mito 9.666, nucl 8, cyto_nucl 7.833, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MRRLLAPFLRRGIPTRSYYRSPALIRTYRTRPNHPKPFNSQAEDLFKLDKRLKRVVYIAEQETVRQERVRTWDRRLAVVLLIGTSLAVLSSWVSQDPGWNEKERKKERKKERKRERKKESNTGTCDVKGVHDKIFRKVNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.45
3 0.47
4 0.47
5 0.5
6 0.5
7 0.51
8 0.47
9 0.47
10 0.48
11 0.47
12 0.47
13 0.5
14 0.53
15 0.55
16 0.59
17 0.63
18 0.65
19 0.71
20 0.77
21 0.77
22 0.77
23 0.76
24 0.8
25 0.75
26 0.69
27 0.6
28 0.54
29 0.52
30 0.48
31 0.4
32 0.33
33 0.28
34 0.28
35 0.32
36 0.31
37 0.3
38 0.35
39 0.36
40 0.36
41 0.38
42 0.37
43 0.36
44 0.37
45 0.33
46 0.29
47 0.28
48 0.25
49 0.25
50 0.22
51 0.18
52 0.14
53 0.14
54 0.13
55 0.2
56 0.28
57 0.29
58 0.32
59 0.36
60 0.36
61 0.37
62 0.35
63 0.29
64 0.22
65 0.19
66 0.14
67 0.09
68 0.07
69 0.06
70 0.05
71 0.04
72 0.03
73 0.02
74 0.02
75 0.02
76 0.03
77 0.04
78 0.04
79 0.05
80 0.06
81 0.06
82 0.09
83 0.12
84 0.15
85 0.18
86 0.23
87 0.28
88 0.33
89 0.44
90 0.51
91 0.59
92 0.66
93 0.74
94 0.8
95 0.87
96 0.93
97 0.93
98 0.95
99 0.95
100 0.96
101 0.97
102 0.96
103 0.96
104 0.94
105 0.94
106 0.93
107 0.91
108 0.86
109 0.79
110 0.72
111 0.61
112 0.53
113 0.43
114 0.37
115 0.35
116 0.31
117 0.33
118 0.36
119 0.39
120 0.44