Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074YBA4

Protein Details
Accession A0A074YBA4   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
81-108DTSRLCIRRPGKTRKRIVKQMDKHDKLCHydrophilic
NLS Segment(s)
PositionSequence
89-96RPGKTRKR
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MIGNNRFKREVLVNSSKKTQYGLSDPGGSTPAAVFTCKRPHMNVALRRVRITIELIKHREKLEHGCHCDFEYLKTGKTKRDTSRLCIRRPGKTRKRIVKQMDKHDKLCGCGAFDFPETRKQAADS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.6
3 0.56
4 0.5
5 0.45
6 0.39
7 0.33
8 0.32
9 0.33
10 0.3
11 0.32
12 0.31
13 0.3
14 0.28
15 0.23
16 0.17
17 0.12
18 0.12
19 0.09
20 0.1
21 0.1
22 0.14
23 0.22
24 0.25
25 0.27
26 0.27
27 0.3
28 0.38
29 0.46
30 0.48
31 0.5
32 0.54
33 0.53
34 0.51
35 0.48
36 0.4
37 0.32
38 0.29
39 0.24
40 0.21
41 0.27
42 0.3
43 0.32
44 0.34
45 0.33
46 0.31
47 0.28
48 0.3
49 0.32
50 0.34
51 0.37
52 0.35
53 0.36
54 0.35
55 0.35
56 0.28
57 0.22
58 0.22
59 0.18
60 0.19
61 0.24
62 0.25
63 0.29
64 0.35
65 0.41
66 0.4
67 0.49
68 0.51
69 0.52
70 0.61
71 0.63
72 0.6
73 0.62
74 0.6
75 0.6
76 0.66
77 0.7
78 0.7
79 0.73
80 0.8
81 0.81
82 0.86
83 0.86
84 0.88
85 0.87
86 0.86
87 0.87
88 0.88
89 0.83
90 0.75
91 0.73
92 0.64
93 0.56
94 0.52
95 0.42
96 0.33
97 0.29
98 0.29
99 0.24
100 0.25
101 0.26
102 0.23
103 0.3
104 0.31
105 0.31