Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074XXA8

Protein Details
Accession A0A074XXA8   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
99-120AGICTCKKCRSGRRRAKAAAAAHydrophilic
NLS Segment(s)
PositionSequence
110-125GRRRAKAAAAAATRAR
Subcellular Location(s) mito 14, cyto 6, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038986  Clr2  
IPR031915  Clr2_N  
Gene Ontology GO:0070824  C:SHREC complex  
GO:0031507  P:heterochromatin formation  
Pfam View protein in Pfam  
PF16761  Clr2_transil  
Amino Acid Sequences MAYRNLRSYPSDGSSARWPRDQANVLVDPPVDFLASLERFFHRQYTFSDMPQGYAVFNHTRNDQTTRAHDTHIYGHKEGHYVSAREFGPHFCCLARVMAGICTCKKCRSGRRRAKAAAAAATRARNPRPLPPTHTLFW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.44
4 0.43
5 0.41
6 0.39
7 0.46
8 0.46
9 0.39
10 0.37
11 0.36
12 0.33
13 0.32
14 0.3
15 0.21
16 0.19
17 0.16
18 0.1
19 0.07
20 0.07
21 0.12
22 0.13
23 0.13
24 0.14
25 0.15
26 0.17
27 0.18
28 0.22
29 0.17
30 0.18
31 0.2
32 0.27
33 0.28
34 0.26
35 0.33
36 0.28
37 0.27
38 0.27
39 0.24
40 0.15
41 0.14
42 0.16
43 0.12
44 0.14
45 0.14
46 0.14
47 0.16
48 0.18
49 0.22
50 0.21
51 0.21
52 0.23
53 0.28
54 0.28
55 0.27
56 0.25
57 0.23
58 0.26
59 0.3
60 0.29
61 0.23
62 0.24
63 0.23
64 0.24
65 0.22
66 0.21
67 0.18
68 0.15
69 0.15
70 0.2
71 0.19
72 0.19
73 0.2
74 0.17
75 0.18
76 0.18
77 0.18
78 0.13
79 0.14
80 0.14
81 0.14
82 0.12
83 0.1
84 0.09
85 0.12
86 0.13
87 0.15
88 0.17
89 0.21
90 0.23
91 0.25
92 0.31
93 0.37
94 0.46
95 0.54
96 0.63
97 0.7
98 0.78
99 0.85
100 0.83
101 0.82
102 0.77
103 0.71
104 0.67
105 0.57
106 0.51
107 0.45
108 0.43
109 0.4
110 0.39
111 0.37
112 0.37
113 0.39
114 0.45
115 0.48
116 0.52
117 0.55
118 0.57