Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074YPQ8

Protein Details
Accession A0A074YPQ8    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
23-50NVPKTRRTYCKGKDCKKHTQHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 9.5, mito 7, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MASSEQSFVPIKLEVNIGCALVNVPKTRRTYCKGKDCKKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTACKTKAQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.17
4 0.15
5 0.14
6 0.13
7 0.12
8 0.12
9 0.15
10 0.16
11 0.17
12 0.23
13 0.28
14 0.33
15 0.39
16 0.43
17 0.5
18 0.56
19 0.64
20 0.7
21 0.75
22 0.8
23 0.8
24 0.85
25 0.85
26 0.86
27 0.85
28 0.85
29 0.83
30 0.83
31 0.86
32 0.78
33 0.77
34 0.7
35 0.64
36 0.56
37 0.51
38 0.4
39 0.31
40 0.3
41 0.29
42 0.28
43 0.25
44 0.31
45 0.34
46 0.38
47 0.42
48 0.46
49 0.43
50 0.49
51 0.57
52 0.54
53 0.56
54 0.55
55 0.55
56 0.54
57 0.57
58 0.49
59 0.45
60 0.41
61 0.34
62 0.37
63 0.39
64 0.38
65 0.33
66 0.4
67 0.44
68 0.53
69 0.61
70 0.64
71 0.64
72 0.67
73 0.74
74 0.74
75 0.73
76 0.7
77 0.65
78 0.62
79 0.6
80 0.55
81 0.5
82 0.48
83 0.41
84 0.36
85 0.33
86 0.32
87 0.36
88 0.42
89 0.44
90 0.47
91 0.57
92 0.64
93 0.69
94 0.66
95 0.61
96 0.56
97 0.51
98 0.5
99 0.5
100 0.51
101 0.52
102 0.55
103 0.52
104 0.5
105 0.49
106 0.42