Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7F7I4

Protein Details
Accession A7F7I4    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
137-165SGFILKTQPKKGKKDKSEKKAARKAKADKBasic
NLS Segment(s)
PositionSequence
144-167QPKKGKKDKSEKKAARKAKADKGE
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR016024  ARM-type_fold  
IPR045196  IF2/IF5  
IPR002735  Transl_init_fac_IF2/IF5_dom  
IPR016189  Transl_init_fac_IF2/IF5_N  
IPR016190  Transl_init_fac_IF2/IF5_Zn-bd  
IPR003307  W2_domain  
Gene Ontology GO:0005829  C:cytosol  
GO:0071074  F:eukaryotic initiation factor eIF2 binding  
GO:0005092  F:GDP-dissociation inhibitor activity  
GO:0005525  F:GTP binding  
GO:0003743  F:translation initiation factor activity  
GO:0001732  P:formation of cytoplasmic translation initiation complex  
GO:0001731  P:formation of translation preinitiation complex  
KEGG ssl:SS1G_13564  -  
Pfam View protein in Pfam  
PF01873  eIF-5_eIF-2B  
PF02020  W2  
PROSITE View protein in PROSITE  
PS51363  W2  
CDD cd11561  W2_eIF5  
Amino Acid Sequences MATVNIRRDVKDNFYRYKMEKIQSKIEGKGNGIKTVIVNLTSIANSLARPGAYVIKYFGFELGAQTNTNPADDRWIINGAHEASKLQDYLDGFINKFVLCKECKNPETEVIFKDGNIVLDCKACGKRSMVDPRLKLSGFILKTQPKKGKKDKSEKKAARKAKADKGEAKENGNGSGSENASENGSNDNNGNGEVTLDAPSDDELVRQAEELQQSTEVKDDDWAVDMSPEAIKARQQQLPDDLKQKLVLGGGGGDEDDDEESGGNSTYDQLANWIEEQTADKGDVSKVDDLEIYRKAKELGIEAKHRTLVILALTLFDDNIVKQIPKRAGMLKNMITSEKHEKSLLGGIERFIGLRGQKNPEFYEKTSKVLMVLYDQELLTEEVLTKWGTKASKKYTNDLAVSKKVRKSAEEFLKWLAEAESDDDDSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.59
4 0.64
5 0.63
6 0.61
7 0.62
8 0.61
9 0.64
10 0.66
11 0.68
12 0.64
13 0.62
14 0.58
15 0.53
16 0.56
17 0.5
18 0.44
19 0.39
20 0.35
21 0.29
22 0.29
23 0.27
24 0.19
25 0.17
26 0.15
27 0.16
28 0.14
29 0.14
30 0.11
31 0.1
32 0.1
33 0.11
34 0.12
35 0.1
36 0.11
37 0.12
38 0.18
39 0.18
40 0.2
41 0.2
42 0.2
43 0.21
44 0.21
45 0.19
46 0.14
47 0.13
48 0.15
49 0.15
50 0.15
51 0.14
52 0.14
53 0.17
54 0.16
55 0.17
56 0.15
57 0.12
58 0.18
59 0.19
60 0.21
61 0.19
62 0.22
63 0.22
64 0.21
65 0.25
66 0.21
67 0.21
68 0.2
69 0.17
70 0.16
71 0.18
72 0.17
73 0.13
74 0.14
75 0.12
76 0.14
77 0.2
78 0.2
79 0.19
80 0.19
81 0.2
82 0.17
83 0.18
84 0.17
85 0.16
86 0.17
87 0.22
88 0.28
89 0.36
90 0.38
91 0.41
92 0.42
93 0.44
94 0.47
95 0.45
96 0.39
97 0.35
98 0.33
99 0.29
100 0.3
101 0.23
102 0.2
103 0.17
104 0.16
105 0.13
106 0.14
107 0.14
108 0.15
109 0.17
110 0.17
111 0.18
112 0.19
113 0.22
114 0.3
115 0.41
116 0.44
117 0.48
118 0.49
119 0.49
120 0.52
121 0.48
122 0.4
123 0.31
124 0.31
125 0.25
126 0.26
127 0.3
128 0.32
129 0.36
130 0.44
131 0.51
132 0.51
133 0.59
134 0.67
135 0.71
136 0.75
137 0.82
138 0.84
139 0.85
140 0.89
141 0.87
142 0.88
143 0.87
144 0.85
145 0.82
146 0.81
147 0.79
148 0.76
149 0.76
150 0.71
151 0.69
152 0.65
153 0.65
154 0.58
155 0.53
156 0.47
157 0.4
158 0.35
159 0.28
160 0.23
161 0.16
162 0.17
163 0.14
164 0.12
165 0.11
166 0.1
167 0.1
168 0.1
169 0.09
170 0.09
171 0.09
172 0.09
173 0.09
174 0.09
175 0.08
176 0.08
177 0.08
178 0.05
179 0.05
180 0.05
181 0.05
182 0.06
183 0.05
184 0.05
185 0.05
186 0.05
187 0.06
188 0.06
189 0.05
190 0.06
191 0.06
192 0.06
193 0.06
194 0.07
195 0.08
196 0.09
197 0.1
198 0.09
199 0.1
200 0.1
201 0.11
202 0.11
203 0.09
204 0.08
205 0.08
206 0.08
207 0.07
208 0.08
209 0.08
210 0.07
211 0.06
212 0.06
213 0.06
214 0.06
215 0.06
216 0.05
217 0.05
218 0.08
219 0.13
220 0.18
221 0.2
222 0.21
223 0.22
224 0.29
225 0.34
226 0.35
227 0.36
228 0.32
229 0.3
230 0.29
231 0.28
232 0.21
233 0.16
234 0.12
235 0.07
236 0.07
237 0.06
238 0.05
239 0.05
240 0.04
241 0.03
242 0.03
243 0.04
244 0.03
245 0.03
246 0.03
247 0.04
248 0.04
249 0.04
250 0.04
251 0.04
252 0.05
253 0.06
254 0.06
255 0.06
256 0.07
257 0.08
258 0.09
259 0.09
260 0.09
261 0.08
262 0.08
263 0.1
264 0.09
265 0.09
266 0.09
267 0.09
268 0.1
269 0.1
270 0.11
271 0.12
272 0.13
273 0.13
274 0.13
275 0.14
276 0.14
277 0.17
278 0.2
279 0.19
280 0.18
281 0.18
282 0.19
283 0.19
284 0.19
285 0.21
286 0.23
287 0.27
288 0.33
289 0.35
290 0.35
291 0.35
292 0.33
293 0.29
294 0.21
295 0.17
296 0.11
297 0.11
298 0.09
299 0.09
300 0.09
301 0.09
302 0.08
303 0.07
304 0.07
305 0.05
306 0.07
307 0.08
308 0.08
309 0.1
310 0.17
311 0.2
312 0.22
313 0.26
314 0.32
315 0.36
316 0.41
317 0.47
318 0.44
319 0.44
320 0.43
321 0.42
322 0.35
323 0.35
324 0.39
325 0.35
326 0.33
327 0.3
328 0.28
329 0.29
330 0.33
331 0.3
332 0.24
333 0.22
334 0.2
335 0.21
336 0.21
337 0.19
338 0.14
339 0.15
340 0.14
341 0.2
342 0.25
343 0.31
344 0.33
345 0.38
346 0.41
347 0.46
348 0.48
349 0.46
350 0.51
351 0.45
352 0.46
353 0.43
354 0.4
355 0.33
356 0.29
357 0.26
358 0.18
359 0.2
360 0.19
361 0.19
362 0.18
363 0.17
364 0.17
365 0.17
366 0.13
367 0.11
368 0.1
369 0.08
370 0.1
371 0.1
372 0.1
373 0.1
374 0.15
375 0.19
376 0.25
377 0.34
378 0.42
379 0.51
380 0.54
381 0.6
382 0.64
383 0.66
384 0.65
385 0.62
386 0.59
387 0.58
388 0.62
389 0.63
390 0.59
391 0.58
392 0.56
393 0.55
394 0.55
395 0.57
396 0.6
397 0.58
398 0.57
399 0.54
400 0.53
401 0.47
402 0.42
403 0.32
404 0.22
405 0.17
406 0.18
407 0.18