Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074YSD7

Protein Details
Accession A0A074YSD7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
149-169SSTVSKANSKKKKAADKDDDEHydrophilic
NLS Segment(s)
PositionSequence
159-161KKK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015418  Eaf6  
Gene Ontology GO:0035267  C:NuA4 histone acetyltransferase complex  
GO:0005634  C:nucleus  
GO:0006325  P:chromatin organization  
GO:0006281  P:DNA repair  
GO:0016573  P:histone acetylation  
Pfam View protein in Pfam  
PF09340  NuA4  
Amino Acid Sequences MTDNAAASAANTDQPGRPYYESLRNTLKSTLIKKRQLDEQLQALEDNIYKMESSYLEETNGAGNIVRGFDGWVKGVVVGGDKKSIDDRKARVRVRDEDRIFSRSSMSWIRAQDSDMPTSATNTPSHAPTPASSVPPQLTSRDSNHPTPSSTVSKANSKKKKAADKDDDEDNGPAKRKKISYGPH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.21
4 0.22
5 0.25
6 0.3
7 0.38
8 0.38
9 0.41
10 0.47
11 0.44
12 0.45
13 0.43
14 0.42
15 0.39
16 0.44
17 0.5
18 0.51
19 0.57
20 0.59
21 0.61
22 0.64
23 0.64
24 0.61
25 0.55
26 0.51
27 0.45
28 0.41
29 0.38
30 0.3
31 0.24
32 0.19
33 0.15
34 0.09
35 0.08
36 0.07
37 0.07
38 0.08
39 0.07
40 0.1
41 0.12
42 0.13
43 0.13
44 0.13
45 0.13
46 0.13
47 0.12
48 0.09
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.05
55 0.06
56 0.07
57 0.08
58 0.08
59 0.08
60 0.08
61 0.08
62 0.08
63 0.07
64 0.07
65 0.08
66 0.08
67 0.09
68 0.09
69 0.09
70 0.14
71 0.16
72 0.18
73 0.22
74 0.25
75 0.33
76 0.42
77 0.44
78 0.45
79 0.48
80 0.52
81 0.53
82 0.59
83 0.51
84 0.47
85 0.47
86 0.45
87 0.4
88 0.32
89 0.28
90 0.18
91 0.2
92 0.18
93 0.18
94 0.19
95 0.2
96 0.22
97 0.21
98 0.21
99 0.24
100 0.24
101 0.22
102 0.19
103 0.19
104 0.17
105 0.19
106 0.19
107 0.15
108 0.13
109 0.14
110 0.15
111 0.15
112 0.16
113 0.15
114 0.15
115 0.14
116 0.2
117 0.2
118 0.22
119 0.21
120 0.23
121 0.23
122 0.25
123 0.26
124 0.22
125 0.24
126 0.24
127 0.28
128 0.34
129 0.37
130 0.38
131 0.43
132 0.42
133 0.4
134 0.39
135 0.4
136 0.36
137 0.34
138 0.35
139 0.33
140 0.41
141 0.48
142 0.56
143 0.6
144 0.62
145 0.67
146 0.71
147 0.78
148 0.79
149 0.81
150 0.81
151 0.79
152 0.77
153 0.75
154 0.69
155 0.6
156 0.52
157 0.44
158 0.38
159 0.36
160 0.36
161 0.32
162 0.37
163 0.37
164 0.42