Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7E942

Protein Details
Accession A7E942    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
22-41GMRKNGKQWHPVKKAFRPKABasic
96-121KMAEKMHQKRVDRLKRREKRNKMLKSBasic
NLS Segment(s)
PositionSequence
63-121EKEMKEEKEQARQAHITKIREKRANKEERERYEKMAEKMHQKRVDRLKRREKRNKMLKS
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
KEGG ssl:SS1G_01822  -  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSTEIAPTTVAPESTSAATPQGMRKNGKQWHPVKKAFRPKAGNTSYQQRKANDLAVALVKAKEKEMKEEKEQARQAHITKIREKRANKEERERYEKMAEKMHQKRVDRLKRREKRNKMLKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.13
4 0.13
5 0.14
6 0.15
7 0.2
8 0.26
9 0.3
10 0.33
11 0.37
12 0.45
13 0.51
14 0.56
15 0.6
16 0.61
17 0.66
18 0.71
19 0.75
20 0.74
21 0.77
22 0.8
23 0.77
24 0.77
25 0.73
26 0.68
27 0.7
28 0.66
29 0.61
30 0.53
31 0.57
32 0.56
33 0.56
34 0.56
35 0.47
36 0.47
37 0.44
38 0.43
39 0.34
40 0.26
41 0.2
42 0.16
43 0.16
44 0.12
45 0.11
46 0.09
47 0.08
48 0.09
49 0.13
50 0.13
51 0.2
52 0.27
53 0.3
54 0.34
55 0.43
56 0.45
57 0.48
58 0.52
59 0.45
60 0.42
61 0.42
62 0.39
63 0.37
64 0.41
65 0.37
66 0.41
67 0.48
68 0.52
69 0.56
70 0.58
71 0.59
72 0.64
73 0.69
74 0.68
75 0.71
76 0.72
77 0.73
78 0.78
79 0.71
80 0.66
81 0.65
82 0.64
83 0.56
84 0.55
85 0.51
86 0.54
87 0.59
88 0.64
89 0.63
90 0.6
91 0.66
92 0.69
93 0.76
94 0.76
95 0.78
96 0.8
97 0.82
98 0.91
99 0.92
100 0.92
101 0.92