Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7F2R7

Protein Details
Accession A7F2R7    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-58MAGLKLKKRARSRSPERDTDKTYRKRSQSPRRDRKRSPVRERRREREREPERERRPSPBasic
NLS Segment(s)
PositionSequence
5-60KLKKRARSRSPERDTDKTYRKRSQSPRRDRKRSPVRERRREREREPERERRPSPPR
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR039732  Hub1/Ubl5  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0031386  F:protein tag  
GO:0000398  P:mRNA splicing, via spliceosome  
GO:0036211  P:protein modification process  
KEGG ssl:SS1G_12215  -  
Amino Acid Sequences MAGLKLKKRARSRSPERDTDKTYRKRSQSPRRDRKRSPVRERRREREREPERERRPSPPRAAADENDLDIAGKFGTSSTAKAQKKDEQSLKDTETPEEEDTLDIASKFGASAFSKFKASSASSSSSKPKTQSSDSANPPVRPPAAPISTAVSASAAPSNEPMIIVHVNDRLGTKAAIPCLASDPIRLFKAQVAARIGRQPHEIMLKRQGERPFKDKLTLEDYGVGNGVQIDLEIDTGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.86
4 0.83
5 0.8
6 0.79
7 0.79
8 0.77
9 0.78
10 0.77
11 0.77
12 0.79
13 0.83
14 0.84
15 0.85
16 0.86
17 0.88
18 0.91
19 0.94
20 0.91
21 0.91
22 0.91
23 0.91
24 0.91
25 0.91
26 0.91
27 0.92
28 0.94
29 0.93
30 0.92
31 0.91
32 0.86
33 0.86
34 0.84
35 0.84
36 0.82
37 0.83
38 0.81
39 0.81
40 0.78
41 0.76
42 0.75
43 0.73
44 0.71
45 0.69
46 0.65
47 0.62
48 0.63
49 0.54
50 0.52
51 0.44
52 0.37
53 0.28
54 0.24
55 0.18
56 0.13
57 0.12
58 0.06
59 0.05
60 0.04
61 0.04
62 0.07
63 0.07
64 0.09
65 0.14
66 0.24
67 0.26
68 0.29
69 0.33
70 0.37
71 0.43
72 0.5
73 0.51
74 0.47
75 0.49
76 0.5
77 0.49
78 0.46
79 0.41
80 0.33
81 0.29
82 0.27
83 0.23
84 0.2
85 0.17
86 0.12
87 0.11
88 0.11
89 0.09
90 0.06
91 0.06
92 0.05
93 0.04
94 0.04
95 0.04
96 0.06
97 0.06
98 0.09
99 0.11
100 0.13
101 0.14
102 0.14
103 0.14
104 0.15
105 0.15
106 0.14
107 0.15
108 0.18
109 0.19
110 0.21
111 0.26
112 0.26
113 0.27
114 0.27
115 0.28
116 0.29
117 0.3
118 0.34
119 0.37
120 0.42
121 0.43
122 0.49
123 0.48
124 0.45
125 0.42
126 0.39
127 0.32
128 0.25
129 0.24
130 0.22
131 0.2
132 0.2
133 0.2
134 0.21
135 0.2
136 0.2
137 0.17
138 0.11
139 0.1
140 0.1
141 0.11
142 0.07
143 0.07
144 0.07
145 0.08
146 0.08
147 0.08
148 0.07
149 0.08
150 0.09
151 0.09
152 0.1
153 0.11
154 0.11
155 0.12
156 0.12
157 0.11
158 0.11
159 0.11
160 0.12
161 0.13
162 0.14
163 0.15
164 0.14
165 0.14
166 0.16
167 0.18
168 0.16
169 0.15
170 0.17
171 0.2
172 0.21
173 0.2
174 0.18
175 0.18
176 0.25
177 0.25
178 0.26
179 0.27
180 0.28
181 0.31
182 0.36
183 0.35
184 0.3
185 0.32
186 0.28
187 0.27
188 0.34
189 0.35
190 0.35
191 0.42
192 0.47
193 0.46
194 0.52
195 0.56
196 0.56
197 0.58
198 0.57
199 0.56
200 0.51
201 0.56
202 0.52
203 0.49
204 0.47
205 0.43
206 0.4
207 0.38
208 0.35
209 0.29
210 0.28
211 0.22
212 0.15
213 0.13
214 0.12
215 0.06
216 0.05
217 0.05
218 0.05