Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074XXJ8

Protein Details
Accession A0A074XXJ8    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
173-205DARKERREERVERVKRNERRERANERRNAPNKSBasic
NLS Segment(s)
PositionSequence
116-127AKKKGIKDKKRD
164-205KTRKDGGEHDARKERREERVERVKRNERRERANERRNAPNKS
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MSIDEMQIDTEVAAGSKPRLPVTVSKPIPYTFDLGNLLCNDTNPLPPVSTISESDIKDAARDCAQALINQLLSTCPITKSDDSTSVTLGLPTPTTPMPREKPVPEEKPMTKWQEFAKKKGIKDKKRDGKLVYDQASGEWLPKYGYKGKNKNGENDWLVEVDEKKTRKDGGEHDARKERREERVERVKRNERRERANERRNAPNKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.12
4 0.14
5 0.15
6 0.17
7 0.19
8 0.27
9 0.33
10 0.42
11 0.4
12 0.41
13 0.43
14 0.42
15 0.43
16 0.37
17 0.33
18 0.22
19 0.23
20 0.23
21 0.21
22 0.23
23 0.2
24 0.2
25 0.17
26 0.17
27 0.17
28 0.16
29 0.18
30 0.16
31 0.17
32 0.15
33 0.15
34 0.17
35 0.17
36 0.18
37 0.17
38 0.19
39 0.24
40 0.24
41 0.25
42 0.24
43 0.2
44 0.19
45 0.19
46 0.17
47 0.13
48 0.13
49 0.12
50 0.14
51 0.15
52 0.14
53 0.16
54 0.15
55 0.14
56 0.13
57 0.13
58 0.09
59 0.1
60 0.1
61 0.09
62 0.08
63 0.09
64 0.13
65 0.14
66 0.18
67 0.19
68 0.22
69 0.23
70 0.23
71 0.22
72 0.2
73 0.19
74 0.15
75 0.13
76 0.09
77 0.07
78 0.07
79 0.08
80 0.08
81 0.09
82 0.11
83 0.16
84 0.19
85 0.23
86 0.27
87 0.26
88 0.32
89 0.38
90 0.4
91 0.38
92 0.41
93 0.38
94 0.39
95 0.44
96 0.43
97 0.36
98 0.35
99 0.36
100 0.41
101 0.43
102 0.41
103 0.46
104 0.45
105 0.47
106 0.55
107 0.6
108 0.59
109 0.66
110 0.73
111 0.73
112 0.74
113 0.78
114 0.7
115 0.67
116 0.66
117 0.64
118 0.56
119 0.47
120 0.41
121 0.35
122 0.34
123 0.26
124 0.19
125 0.12
126 0.09
127 0.09
128 0.1
129 0.15
130 0.21
131 0.29
132 0.38
133 0.47
134 0.54
135 0.62
136 0.64
137 0.67
138 0.62
139 0.61
140 0.53
141 0.47
142 0.4
143 0.31
144 0.29
145 0.24
146 0.21
147 0.17
148 0.21
149 0.2
150 0.21
151 0.24
152 0.26
153 0.27
154 0.32
155 0.35
156 0.39
157 0.48
158 0.5
159 0.54
160 0.61
161 0.6
162 0.58
163 0.59
164 0.55
165 0.54
166 0.59
167 0.57
168 0.58
169 0.67
170 0.73
171 0.74
172 0.8
173 0.8
174 0.8
175 0.85
176 0.86
177 0.83
178 0.84
179 0.85
180 0.86
181 0.87
182 0.88
183 0.86
184 0.81
185 0.84