Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074ZMB8

Protein Details
Accession A0A074ZMB8    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
85-105AARRLPRTSTSRDRRPRSSRPHydrophilic
NLS Segment(s)
PositionSequence
97-104DRRPRSSR
Subcellular Location(s) mito 10, nucl 6, extr 5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MVVLARPPASLLPLSKLCHWLLNHLSFFFYRTSSCLPLSELPALPALSSPTLRLPASRSLLAEWLLVTPALPGPVVLLPVTLSPAARRLPRTSTSRDRRPRSSRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.3
4 0.28
5 0.32
6 0.3
7 0.31
8 0.33
9 0.36
10 0.35
11 0.32
12 0.32
13 0.27
14 0.28
15 0.22
16 0.17
17 0.11
18 0.13
19 0.16
20 0.17
21 0.18
22 0.17
23 0.18
24 0.19
25 0.21
26 0.21
27 0.17
28 0.16
29 0.16
30 0.15
31 0.12
32 0.11
33 0.09
34 0.08
35 0.08
36 0.08
37 0.08
38 0.1
39 0.1
40 0.1
41 0.12
42 0.16
43 0.18
44 0.18
45 0.18
46 0.16
47 0.18
48 0.18
49 0.15
50 0.11
51 0.08
52 0.07
53 0.07
54 0.06
55 0.05
56 0.05
57 0.05
58 0.05
59 0.04
60 0.05
61 0.06
62 0.07
63 0.06
64 0.06
65 0.06
66 0.06
67 0.08
68 0.07
69 0.07
70 0.07
71 0.11
72 0.15
73 0.19
74 0.23
75 0.26
76 0.31
77 0.38
78 0.43
79 0.48
80 0.55
81 0.61
82 0.68
83 0.75
84 0.77
85 0.81