Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7EM43

Protein Details
Accession A7EM43    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
58-77IGLTYIRYRKKNKGNKQVRVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
KEGG ssl:SS1G_06390  -  
Amino Acid Sequences MALEDQDGLGRSLEMDDGGRGLARGVLLSKYQGGEDNEEEEEEEEEEGGGGMEMEMGIGLTYIRYRKKNKGNKQVRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.07
6 0.06
7 0.06
8 0.05
9 0.06
10 0.05
11 0.05
12 0.06
13 0.07
14 0.07
15 0.08
16 0.09
17 0.08
18 0.09
19 0.12
20 0.12
21 0.14
22 0.14
23 0.15
24 0.14
25 0.14
26 0.14
27 0.1
28 0.1
29 0.07
30 0.06
31 0.05
32 0.04
33 0.04
34 0.04
35 0.03
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.03
48 0.05
49 0.1
50 0.17
51 0.25
52 0.31
53 0.42
54 0.53
55 0.63
56 0.72
57 0.79