Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7F6N3

Protein Details
Accession A7F6N3   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-46IRSNRGCWTCRIRKKKCDELQPGCSRCHydrophilic
NLS Segment(s)
PositionSequence
86-87KR
Subcellular Location(s) nucl 16, cyto 5, mito 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021858  Fun_TF  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0000976  F:transcription cis-regulatory region binding  
GO:0008270  F:zinc ion binding  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
KEGG ssl:SS1G_13262  -  
Pfam View protein in Pfam  
PF11951  Fungal_trans_2  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MDNTTSGSNAIADTNLSLAIRSNRGCWTCRIRKKKCDELQPGCSRCADVNVECRYGPKPKWIDDPKFGKIELERIKAIVAASANKKRAAFRARKTSNPTSSLLKSTPKSSSTTKNPGKESKLSSIDNVVSKSTNMEMVHDKTIEPKSSLFPKWIEDQEASLMMHYLDHVFFIQFRFHTPSLSSGRGWLLSLLIRTKPLYHAALSLSAFHRQSLLVEQESGQAEIDYLHELRHHHDLTLKELRNFIQSNNKNVSEQGAFDGNIQILACMIQLISFELFHGGVSNWQVHLRAASELILILHEVSNGGIPSSETSLISSQCFNHPYAHSLESITSGITVSRDSAALDFFTGAIIWMDALSCVSTGSHPMAFRISQSTPLGQKIRLLVTRPLKVRPQIQLPSIMGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.08
5 0.11
6 0.16
7 0.21
8 0.22
9 0.24
10 0.31
11 0.34
12 0.37
13 0.41
14 0.47
15 0.52
16 0.62
17 0.7
18 0.73
19 0.8
20 0.87
21 0.9
22 0.88
23 0.88
24 0.88
25 0.86
26 0.86
27 0.86
28 0.8
29 0.7
30 0.62
31 0.53
32 0.43
33 0.39
34 0.34
35 0.28
36 0.33
37 0.36
38 0.37
39 0.35
40 0.37
41 0.35
42 0.38
43 0.36
44 0.37
45 0.39
46 0.42
47 0.52
48 0.6
49 0.64
50 0.65
51 0.7
52 0.65
53 0.62
54 0.57
55 0.5
56 0.42
57 0.44
58 0.42
59 0.39
60 0.35
61 0.32
62 0.32
63 0.3
64 0.28
65 0.21
66 0.15
67 0.17
68 0.24
69 0.3
70 0.33
71 0.34
72 0.36
73 0.36
74 0.43
75 0.47
76 0.49
77 0.51
78 0.6
79 0.62
80 0.67
81 0.73
82 0.74
83 0.71
84 0.65
85 0.59
86 0.54
87 0.52
88 0.49
89 0.43
90 0.4
91 0.35
92 0.35
93 0.36
94 0.32
95 0.34
96 0.35
97 0.41
98 0.43
99 0.52
100 0.55
101 0.57
102 0.61
103 0.64
104 0.65
105 0.62
106 0.58
107 0.55
108 0.54
109 0.48
110 0.43
111 0.4
112 0.38
113 0.34
114 0.29
115 0.23
116 0.18
117 0.17
118 0.17
119 0.14
120 0.15
121 0.12
122 0.14
123 0.17
124 0.2
125 0.22
126 0.21
127 0.2
128 0.22
129 0.25
130 0.24
131 0.21
132 0.19
133 0.21
134 0.27
135 0.28
136 0.25
137 0.23
138 0.24
139 0.28
140 0.28
141 0.27
142 0.21
143 0.21
144 0.19
145 0.2
146 0.17
147 0.12
148 0.1
149 0.07
150 0.07
151 0.06
152 0.06
153 0.05
154 0.05
155 0.05
156 0.05
157 0.06
158 0.07
159 0.09
160 0.08
161 0.1
162 0.16
163 0.16
164 0.17
165 0.17
166 0.21
167 0.23
168 0.25
169 0.23
170 0.19
171 0.19
172 0.18
173 0.18
174 0.12
175 0.09
176 0.08
177 0.09
178 0.09
179 0.09
180 0.1
181 0.1
182 0.11
183 0.11
184 0.13
185 0.14
186 0.12
187 0.13
188 0.13
189 0.15
190 0.14
191 0.15
192 0.13
193 0.14
194 0.14
195 0.13
196 0.13
197 0.1
198 0.11
199 0.11
200 0.13
201 0.1
202 0.11
203 0.11
204 0.13
205 0.14
206 0.13
207 0.11
208 0.08
209 0.08
210 0.08
211 0.08
212 0.06
213 0.06
214 0.06
215 0.08
216 0.09
217 0.11
218 0.17
219 0.16
220 0.16
221 0.2
222 0.2
223 0.25
224 0.34
225 0.34
226 0.29
227 0.3
228 0.3
229 0.31
230 0.31
231 0.27
232 0.28
233 0.3
234 0.35
235 0.38
236 0.38
237 0.33
238 0.33
239 0.34
240 0.24
241 0.21
242 0.17
243 0.13
244 0.13
245 0.13
246 0.14
247 0.1
248 0.1
249 0.09
250 0.07
251 0.05
252 0.05
253 0.05
254 0.04
255 0.03
256 0.03
257 0.03
258 0.05
259 0.05
260 0.05
261 0.05
262 0.06
263 0.06
264 0.06
265 0.07
266 0.06
267 0.07
268 0.09
269 0.1
270 0.1
271 0.11
272 0.12
273 0.11
274 0.12
275 0.11
276 0.1
277 0.1
278 0.09
279 0.09
280 0.08
281 0.08
282 0.07
283 0.06
284 0.06
285 0.06
286 0.05
287 0.05
288 0.05
289 0.06
290 0.06
291 0.06
292 0.05
293 0.06
294 0.07
295 0.09
296 0.1
297 0.09
298 0.11
299 0.13
300 0.14
301 0.15
302 0.15
303 0.15
304 0.19
305 0.21
306 0.2
307 0.23
308 0.23
309 0.25
310 0.28
311 0.28
312 0.24
313 0.23
314 0.22
315 0.19
316 0.18
317 0.15
318 0.11
319 0.09
320 0.09
321 0.08
322 0.08
323 0.08
324 0.08
325 0.08
326 0.09
327 0.09
328 0.1
329 0.1
330 0.1
331 0.09
332 0.08
333 0.08
334 0.07
335 0.07
336 0.06
337 0.05
338 0.05
339 0.04
340 0.05
341 0.05
342 0.05
343 0.05
344 0.05
345 0.05
346 0.06
347 0.06
348 0.09
349 0.12
350 0.15
351 0.15
352 0.16
353 0.2
354 0.2
355 0.21
356 0.24
357 0.22
358 0.25
359 0.27
360 0.31
361 0.31
362 0.38
363 0.4
364 0.35
365 0.37
366 0.36
367 0.4
368 0.39
369 0.4
370 0.42
371 0.47
372 0.54
373 0.54
374 0.56
375 0.57
376 0.59
377 0.63
378 0.61
379 0.62
380 0.61
381 0.6
382 0.62