Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074Y5P8

Protein Details
Accession A0A074Y5P8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-36SSCLLNCFRKRKFRARLRSLASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, plas 3, cyto 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MTCSVACVVCFVRQSSCLLNCFRKRKFRARLRSLASVATTAFFRGPGCQMAVLRYYNARTILGVLVTASPLCGAPNLVKSVPLLKIHSMSAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.27
4 0.27
5 0.31
6 0.39
7 0.45
8 0.52
9 0.56
10 0.61
11 0.65
12 0.72
13 0.78
14 0.79
15 0.81
16 0.81
17 0.83
18 0.79
19 0.77
20 0.68
21 0.59
22 0.49
23 0.38
24 0.29
25 0.21
26 0.15
27 0.09
28 0.08
29 0.07
30 0.06
31 0.06
32 0.07
33 0.08
34 0.08
35 0.08
36 0.09
37 0.09
38 0.12
39 0.11
40 0.11
41 0.11
42 0.12
43 0.13
44 0.14
45 0.13
46 0.1
47 0.11
48 0.11
49 0.1
50 0.09
51 0.07
52 0.06
53 0.06
54 0.06
55 0.05
56 0.04
57 0.05
58 0.05
59 0.05
60 0.06
61 0.08
62 0.12
63 0.16
64 0.15
65 0.16
66 0.17
67 0.21
68 0.24
69 0.26
70 0.26
71 0.25
72 0.27