Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074ZAT7

Protein Details
Accession A0A074ZAT7    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
12-33NETRTNDDKRPKRPTLQTPLSAHydrophilic
NLS Segment(s)
PositionSequence
154-161RKAKPQSP
172-174KPR
256-261KGKRRK
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MAARSISAPTVNETRTNDDKRPKRPTLQTPLSASYPSEVKSPYPGTPSFIKREEYIKTPVTPPVAYLDFLKSMPTGLASPITTGTSSKFHFSDKVPSEVIEEADEKSPEVTPEMVQPLLSRTNSTSSESSATSVMSSSTESVHSVSSTIPETKRKAKPQSPRVIIPPSPFAKPRSAKLPRNSHVPPSPMSPANVRSPMSARTHYEPHSASGLSGTPWSATYSPTEAESSTTSKMSVRQVVTRTVTYSRTPLDPAPKGKRRKIEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.43
3 0.48
4 0.51
5 0.56
6 0.63
7 0.68
8 0.74
9 0.74
10 0.75
11 0.78
12 0.81
13 0.81
14 0.81
15 0.78
16 0.74
17 0.7
18 0.63
19 0.54
20 0.44
21 0.35
22 0.28
23 0.23
24 0.2
25 0.17
26 0.16
27 0.22
28 0.25
29 0.25
30 0.28
31 0.28
32 0.29
33 0.35
34 0.39
35 0.39
36 0.38
37 0.38
38 0.35
39 0.39
40 0.38
41 0.35
42 0.36
43 0.34
44 0.33
45 0.33
46 0.34
47 0.33
48 0.29
49 0.26
50 0.25
51 0.23
52 0.21
53 0.2
54 0.19
55 0.17
56 0.17
57 0.17
58 0.12
59 0.11
60 0.1
61 0.1
62 0.08
63 0.08
64 0.09
65 0.09
66 0.09
67 0.1
68 0.1
69 0.09
70 0.09
71 0.11
72 0.12
73 0.13
74 0.15
75 0.15
76 0.16
77 0.19
78 0.2
79 0.28
80 0.27
81 0.3
82 0.27
83 0.27
84 0.27
85 0.25
86 0.24
87 0.15
88 0.13
89 0.11
90 0.12
91 0.12
92 0.1
93 0.1
94 0.1
95 0.09
96 0.09
97 0.09
98 0.07
99 0.1
100 0.11
101 0.1
102 0.1
103 0.1
104 0.11
105 0.13
106 0.13
107 0.12
108 0.11
109 0.15
110 0.16
111 0.19
112 0.17
113 0.15
114 0.17
115 0.16
116 0.16
117 0.13
118 0.11
119 0.08
120 0.08
121 0.07
122 0.05
123 0.06
124 0.05
125 0.06
126 0.06
127 0.06
128 0.07
129 0.07
130 0.07
131 0.07
132 0.06
133 0.07
134 0.08
135 0.11
136 0.12
137 0.17
138 0.21
139 0.29
140 0.36
141 0.43
142 0.51
143 0.56
144 0.64
145 0.7
146 0.77
147 0.72
148 0.68
149 0.65
150 0.61
151 0.56
152 0.48
153 0.44
154 0.36
155 0.34
156 0.34
157 0.31
158 0.34
159 0.35
160 0.35
161 0.39
162 0.46
163 0.51
164 0.58
165 0.66
166 0.6
167 0.66
168 0.65
169 0.61
170 0.57
171 0.52
172 0.44
173 0.38
174 0.39
175 0.33
176 0.32
177 0.29
178 0.28
179 0.3
180 0.32
181 0.29
182 0.26
183 0.27
184 0.31
185 0.32
186 0.32
187 0.31
188 0.32
189 0.36
190 0.36
191 0.39
192 0.35
193 0.33
194 0.32
195 0.28
196 0.23
197 0.2
198 0.18
199 0.13
200 0.13
201 0.11
202 0.08
203 0.09
204 0.12
205 0.11
206 0.11
207 0.14
208 0.15
209 0.16
210 0.17
211 0.17
212 0.15
213 0.17
214 0.18
215 0.19
216 0.18
217 0.18
218 0.17
219 0.18
220 0.22
221 0.26
222 0.3
223 0.3
224 0.34
225 0.36
226 0.43
227 0.45
228 0.42
229 0.4
230 0.36
231 0.36
232 0.33
233 0.35
234 0.31
235 0.29
236 0.31
237 0.33
238 0.39
239 0.43
240 0.5
241 0.56
242 0.62
243 0.69
244 0.74