Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074Z0L2

Protein Details
Accession A0A074Z0L2    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
25-52PAVFDDSRRRHRSRRRHRATYNPHIRSTBasic
NLS Segment(s)
PositionSequence
32-42RRRHRSRRRHR
Subcellular Location(s) nucl 14.5, cyto_nucl 9, mito 7, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MHGIYLIYRLRSDFSRQLLERWSGPAVFDDSRRRHRSRRRHRATYNPHIRSTLAANRHCRPRRYCLALTVPRLRPLPPTPSISLAPAACFTQPFAVTVPFPCTSDFTRWFVQTFASRFLISSNRPQALENKYQNYLETGTAVQGQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.39
3 0.39
4 0.41
5 0.43
6 0.43
7 0.38
8 0.34
9 0.32
10 0.23
11 0.22
12 0.21
13 0.21
14 0.19
15 0.23
16 0.29
17 0.34
18 0.44
19 0.51
20 0.54
21 0.6
22 0.69
23 0.75
24 0.78
25 0.83
26 0.83
27 0.86
28 0.88
29 0.89
30 0.89
31 0.89
32 0.88
33 0.81
34 0.72
35 0.63
36 0.55
37 0.45
38 0.4
39 0.35
40 0.32
41 0.33
42 0.37
43 0.4
44 0.5
45 0.54
46 0.55
47 0.54
48 0.54
49 0.57
50 0.59
51 0.56
52 0.51
53 0.55
54 0.54
55 0.55
56 0.54
57 0.48
58 0.43
59 0.42
60 0.37
61 0.32
62 0.29
63 0.3
64 0.26
65 0.28
66 0.26
67 0.28
68 0.29
69 0.25
70 0.24
71 0.19
72 0.16
73 0.13
74 0.12
75 0.09
76 0.09
77 0.08
78 0.09
79 0.09
80 0.09
81 0.09
82 0.1
83 0.11
84 0.11
85 0.15
86 0.14
87 0.14
88 0.14
89 0.16
90 0.18
91 0.24
92 0.26
93 0.26
94 0.29
95 0.29
96 0.29
97 0.27
98 0.27
99 0.26
100 0.25
101 0.25
102 0.24
103 0.23
104 0.22
105 0.24
106 0.27
107 0.24
108 0.31
109 0.34
110 0.34
111 0.35
112 0.36
113 0.41
114 0.43
115 0.5
116 0.48
117 0.46
118 0.47
119 0.46
120 0.46
121 0.42
122 0.37
123 0.27
124 0.22
125 0.18
126 0.16