Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074Y7G3

Protein Details
Accession A0A074Y7G3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
64-85VPIAKKTTGKTKPAKQPATREVHydrophilic
NLS Segment(s)
PositionSequence
33-51TKAAAKKPTTAKKPTTAKK
Subcellular Location(s) mito 13.5, cyto_mito 8.5, extr 8, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSLFFHSIVPFLSFSHPKSHPITATILKAKATTKAAAKKPTTAKKPTTAKKPTTASPSPSPSDVPIAKKTTGKTKPAKQPATREVASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.28
3 0.28
4 0.3
5 0.34
6 0.37
7 0.32
8 0.31
9 0.35
10 0.31
11 0.35
12 0.34
13 0.3
14 0.27
15 0.27
16 0.26
17 0.25
18 0.24
19 0.21
20 0.23
21 0.31
22 0.36
23 0.41
24 0.42
25 0.44
26 0.5
27 0.55
28 0.56
29 0.54
30 0.52
31 0.53
32 0.61
33 0.61
34 0.63
35 0.62
36 0.59
37 0.6
38 0.6
39 0.56
40 0.55
41 0.52
42 0.47
43 0.45
44 0.46
45 0.41
46 0.39
47 0.36
48 0.29
49 0.32
50 0.29
51 0.28
52 0.29
53 0.31
54 0.32
55 0.35
56 0.36
57 0.41
58 0.45
59 0.49
60 0.53
61 0.59
62 0.67
63 0.74
64 0.81
65 0.78
66 0.81
67 0.79
68 0.79