Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7E9T9

Protein Details
Accession A7E9T9    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
156-180LTDQGTKPVARKRRKPWEKDVDEEAHydrophilic
NLS Segment(s)
PositionSequence
166-170RKRRK
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
KEGG ssl:SS1G_02069  -  
Pfam View protein in Pfam  
PF17733  DUF5572  
Amino Acid Sequences MATETSDQSGSSDANIYKDLQSYPWSTDNEFQGGLSAILGNASSPEQIRELTLRAQCFYLSRKRKININFDEYKAYLATHPSTPSSTDVPATTTVLSDPTSSPNTSHPHHENDLPPASTTDDQKTAPYPQSFAEIVALITAGGTIPGIRDIPDTVLTDQGTKPVARKRRKPWEKDVDEEAIQGGGTFGDHRDIIIQQEYPTDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.18
4 0.18
5 0.2
6 0.2
7 0.17
8 0.2
9 0.21
10 0.24
11 0.27
12 0.28
13 0.28
14 0.32
15 0.33
16 0.31
17 0.29
18 0.24
19 0.19
20 0.18
21 0.15
22 0.11
23 0.08
24 0.06
25 0.06
26 0.06
27 0.04
28 0.05
29 0.05
30 0.06
31 0.06
32 0.08
33 0.09
34 0.09
35 0.11
36 0.12
37 0.13
38 0.18
39 0.21
40 0.21
41 0.21
42 0.21
43 0.2
44 0.21
45 0.24
46 0.29
47 0.33
48 0.39
49 0.45
50 0.48
51 0.55
52 0.6
53 0.65
54 0.62
55 0.61
56 0.58
57 0.52
58 0.53
59 0.45
60 0.38
61 0.28
62 0.22
63 0.15
64 0.14
65 0.14
66 0.12
67 0.13
68 0.13
69 0.14
70 0.15
71 0.16
72 0.15
73 0.14
74 0.13
75 0.13
76 0.13
77 0.13
78 0.12
79 0.1
80 0.09
81 0.08
82 0.08
83 0.08
84 0.08
85 0.07
86 0.1
87 0.11
88 0.12
89 0.12
90 0.16
91 0.19
92 0.19
93 0.24
94 0.25
95 0.27
96 0.29
97 0.31
98 0.28
99 0.29
100 0.3
101 0.25
102 0.22
103 0.19
104 0.19
105 0.18
106 0.18
107 0.16
108 0.16
109 0.16
110 0.16
111 0.18
112 0.18
113 0.22
114 0.21
115 0.19
116 0.18
117 0.21
118 0.2
119 0.19
120 0.16
121 0.12
122 0.11
123 0.1
124 0.09
125 0.05
126 0.04
127 0.04
128 0.03
129 0.02
130 0.02
131 0.02
132 0.03
133 0.04
134 0.04
135 0.05
136 0.06
137 0.07
138 0.09
139 0.12
140 0.14
141 0.13
142 0.16
143 0.16
144 0.17
145 0.17
146 0.17
147 0.17
148 0.15
149 0.2
150 0.25
151 0.35
152 0.43
153 0.52
154 0.61
155 0.7
156 0.8
157 0.84
158 0.86
159 0.88
160 0.84
161 0.8
162 0.75
163 0.69
164 0.59
165 0.51
166 0.4
167 0.29
168 0.22
169 0.16
170 0.11
171 0.05
172 0.05
173 0.05
174 0.06
175 0.08
176 0.08
177 0.09
178 0.11
179 0.12
180 0.15
181 0.17
182 0.18
183 0.16